KEGG   Listeria innocua: lin0258Help
Entry
lin0258           CDS       T00067                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lin  Listeria innocua
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lin0258
Enzymes [BR:lin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     lin0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
256920..257399
Genome map
AA seq 159 aa AA seqDB search
MAKAFLSIGTNIGERLDNLNDALRGLADSEKIKITNVSSVYETDAVGYEDQAAFLNIAAE
VETDFTPNELLDFCLALELELGRVRLFKWGPRLIDIDILLYDDVKIDTEKLKIPHPYMKE
RAFVMIPLIEISPEKSNLLENPAILEEQGVRKIKNQVNW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcttttttgtcgattggtacaaacataggggaacgtttagataatctaaat
gatgcactaagaggcctagctgattctgaaaaaatcaaaattactaatgtttctagcgtt
tatgaaacagatgcggtaggttatgaagatcaagcagcatttttaaatatcgcagcggaa
gtcgaaacggactttacgccaaatgaattactagacttttgccttgctctcgaacttgaa
ttggggcgagttcgattgtttaaatgggggccgcgcttaatcgatattgatattctatta
tacgacgatgttaaaatcgatacagaaaagctaaaaatcccacatccttatatgaaagaa
cgcgcttttgtaatgatacctttaatagaaatttcaccagaaaaaagcaatcttttagag
aatccagcaattttagaagaacaaggcgttcgaaaaataaaaaatcaagtgaactggtaa

DBGET integrated database retrieval system