KEGG   Listeria innocua: lin0361Help
Entry
lin0361           CDS       T00067                                 

Definition
putative translaldolase (EC:2.2.1.2)
Orthology
K00616  
transaldolase [EC:2.2.1.2]
Organism
lin  Listeria innocua
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:lin01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lin01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lin00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(376712..377368)
Genome map
AA seq 218 aa AA seqDB search
MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKEICSIVDGPVSAEVIG
LEADKMVEEARILAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKTNVTLIFTVSQGLMAAK
AGATYISPFLGRLDDIGTDGMILIKNLKKVLDNYGLKAEIISASIRHIGHLEEAAEAGAH
IATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttcttggacacagcaagcgtatcggaaataaaacgaattagcgaactaggt
ttagtggacggtgtgacaaccaacccaaccatcatcgctaaagaaggtcgaccatttgaa
gaagtaattaaagaaatttgttctatcgtagacggcccagttagcgcagaagttatcggc
ctcgaagcagacaaaatggtagaagaagctcgaattctagcaaaatgggcgccaaatgta
gtagtaaaaattcctatgacggaagaaggtttaaaagcagtccataccctcacagctgaa
ggcattaaaacaaatgttacgcttattttcactgtttcccaaggattaatggctgcaaaa
gctggcgcaacatatattagcccgttcttaggaagactagatgatattggtacagacgga
atgattttaattaaaaacttgaaaaaagtgcttgataattatggtctaaaagcagaaatc
atttcagcaagtatccgccatatcgggcatttagaagaagccgctgaagccggagcacat
atcgcgactatcccaggaagccttttcccgaaactttggtctcatcctttgactgataaa
ggtattgaaggatttttaaaagattgggaagcgttcagtcagaaagaaggcaattaa

DBGET integrated database retrieval system