KEGG   Listeria innocua: lin0364Help
Entry
lin0364           CDS       T00067                                 

Definition
(GenBank) similar to triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lin  Listeria innocua
Pathway
lin00010  Glycolysis / Gluconeogenesis
lin00051  Fructose and mannose metabolism
lin00562  Inositol phosphate metabolism
lin01100  Metabolic pathways
lin01110  Biosynthesis of secondary metabolites
lin01120  Microbial metabolism in diverse environments
lin01130  Biosynthesis of antibiotics
lin01200  Carbon metabolism
lin01230  Biosynthesis of amino acids
Module
lin_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lin_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lin0364
   00051 Fructose and mannose metabolism
    lin0364
   00562 Inositol phosphate metabolism
    lin0364
Enzymes [BR:lin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lin0364
Exosome [BR:lin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lin0364
  Exosomal proteins of bladder cancer cells
   lin0364
  Exosomal proteins of melanoma cells
   lin0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAC95597
Pasteur: LIN00364
UniProt: Q92EU4
Position
complement(378657..379421)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLENFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEEVHANDTNELKNALKKQIEALFQTINLAQWENVVLAYEPEWAIGKASSAE
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttgaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatctatcattgatctaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagctaagaagattaaactcgcattggacgaa
aaaatcactccggttgtctgtgtgggtgaagaagtccatgcgaatgatacaaatgaatta
aaaaatgcgctaaaaaaacaaatcgaggcgctgtttcagacaattaatttagcacagtgg
gaaaatgttgttctggcttatgaaccggaatgggcaattggaaaggcatcttcagctgag
acaaactacatcgaaagcgctcatcaagctttgcgcgaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system