KEGG   Listeria innocua: lin0364Help
Entry
lin0364           CDS       T00067                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lin  Listeria innocua
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lin0364
   01230 Biosynthesis of amino acids
    lin0364
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lin0364
   00051 Fructose and mannose metabolism
    lin0364
   00562 Inositol phosphate metabolism
    lin0364
Enzymes [BR:lin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lin0364
Exosome [BR:lin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lin0364
  Exosomal proteins of bladder cancer cells
   lin0364
  Exosomal proteins of melanoma cells
   lin0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(378657..379421)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLENFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEEVHANDTNELKNALKKQIEALFQTINLAQWENVVLAYEPEWAIGKASSAE
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttgaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatctatcattgatctaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagctaagaagattaaactcgcattggacgaa
aaaatcactccggttgtctgtgtgggtgaagaagtccatgcgaatgatacaaatgaatta
aaaaatgcgctaaaaaaacaaatcgaggcgctgtttcagacaattaatttagcacagtgg
gaaaatgttgttctggcttatgaaccggaatgggcaattggaaaggcatcttcagctgag
acaaactacatcgaaagcgctcatcaagctttgcgcgaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system