KEGG   Listeria innocua: lin0883Help
Entry
lin0883           CDS       T00067                                 

Definition
(GenBank) similar to protoporphyrinogen IX and coproporphyrinogen III oxidase (HemY)
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
lin  Listeria innocua
Pathway
lin00860  Porphyrin and chlorophyll metabolism
lin01100  Metabolic pathways
lin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lin0883
Enzymes [BR:lin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     lin0883
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     lin0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 NAD_binding_9 Pyr_redox_2 Thi4 HI0933_like FAD_binding_2 Pyr_redox Trp_halogenase FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CAC96115
Pasteur: LIN00883
UniProt: Q92DD1
Position
917224..918603
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDREALLASTLVS
EIGKARALQEPTIEPNNQETDQPLGEFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVRKYGNLMDGLKESTMQTTGTKGTIGAFRTLEGGLDRLPKAIADALPAENLH
TAKQATQITKKNTSYEISFADGDKKEADGVIIAATHDALIHLLAETTTAPFAEQPLTTLA
TVSLAYDEKDVPILPDGTGYLVARTALYKTTACTWVQKKWPHMVPKDKMLLRGFVGKAGE
SWLEQASDEAIVTAVLTDYAEIMDLHAAPLFYEVSRMKSAMPQYLVDHQDRLKQLKKNIQ
TDYPGVYFAGMSYEGVGIPDCIAGAQTAVTELADFLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacacatagtgattatcggaggcggcttatcggggcttgcagcagcttatgaacta
caaaaaacacatccgaattatacgtgggaattagttgaaaaagacgagaaattaggcggg
aaatttgaaacagtaaaacgggacggatttttaattgaaaaaggcccagattccttttta
gctagaaagcctgctggagtgggcttagtgaaggacttaggactcgaagataaattaatt
gcaaatgcgacaggacggtcttacatttaccatcaaaaagcgcttcatccaattccagaa
ggttctgtgatgggaattccaactgatagagaagcacttctagctagcacacttgtctct
gaaataggcaaagcacgcgcactccaagaaccgacaatcgaaccaaataaccaagaaaca
gatcagccacttggcgaattctttgaagcacgtttcggcaaggaattagtgaaaacaatc
attgaacctcttttatcaggaatttacgcgggtgatatatacaaaatgagtttgcgtgct
acatttccgcaatttgaacaaaccgtcagaaagtatggaaatctaatggacgggttgaag
gaaagtactatgcagacaactggcacaaaaggaaccattggcgcctttcgaacgttagaa
ggaggcttagaccgtttaccaaaagcaattgccgacgccctgccagctgaaaacttgcat
acagcgaaacaagcaacacaaatcacgaaaaaaaatacttcttatgaaatttcttttgct
gatggagataaaaaagaagcagatggcgttattattgcagctacacatgatgccctgatt
catttgttagcagaaacgaccacagcaccttttgcagaacaaccactaacgacacttgca
accgtttcattagcttacgacgaaaaagatgtacctattttgccagatggaacaggttat
ttagttgctcgaaccgcactgtataaaacaactgcttgtacttgggtgcaaaaaaaatgg
cctcacatggtaccaaaagataaaatgttattacgtggctttgttggtaaagctggtgaa
tcttggttagagcaagcaagcgatgaagcaatcgtcactgctgtactaacagattatgcg
gaaataatggatttacatgccgccccacttttttatgaagtaagtcgaatgaaatcagct
atgccgcagtatttagtagatcaccaagatcgtcttaaacaattgaaaaaaaacatccag
acagactatccaggtgtttattttgcagggatgagttacgaaggtgtaggaattcctgac
tgtatagctggagcacaaactgcggttactgaattagcagatttcttggaagaggtgtaa

DBGET integrated database retrieval system