KEGG   Listeria innocua: lin0982Help
Entry
lin0982           CDS       T00067                                 

Definition
(GenBank) similar to glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lin  Listeria innocua
Pathway
lin00480  Glutathione metabolism
lin00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    lin0982
  Metabolism of other amino acids
   00480 Glutathione metabolism
    lin0982
Enzymes [BR:lin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     lin0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC INT_SG_DDX_CT_C
Motif
Other DBs
NCBI-ProteinID: CAC96213
Pasteur: LIN00982
UniProt: Q92D38
Position
1006136..1006612
Genome map
AA seq 158 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEKMYKKLGGDNFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDAAPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVERFPSKMKPEDFEDKVEALVAAVK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaatggtaaagaaatagcattaagtgac
tataaaggcaaagttttactcattgtcaacactgcgagcaaatgtggtttaacacctcaa
ctggaaggtcttgaaaaaatgtataaaaaacttggcggagataactttgaaatccttggt
ttcccgtgcaatcagtttttacgtcaagatcctggtagtgatgaagagattttagaattt
tgtcaaatgaattacggcgtgactttccaaatgttctctaaaattaaagtgaaaggcaaa
gatgctgctccactttataaatatttaactgaacaaactggaggcaaaaaagtggaatgg
aactttgccaaattcctcattgatgaaaatggcgaagttgttgaacgtttcccatcaaaa
atgaaaccggaagattttgaggacaaagtagaagcgcttgttgcagcagtcaaataa

DBGET integrated database retrieval system