KEGG   Listeria innocua: lin1046Help
Entry
lin1046           CDS       T00067                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lin  Listeria innocua
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lin01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lin00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lin00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lin00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1063629..1065263
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAPAQASGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEEAELTNNDATSAPATGGNGTPSSKKDPNGLVIAMP
SVRKYAREKDVNIAEVAGSGKNNRVVKADIDAFLNGEQPAAATTTAQTEEKAAAPKAEKA
AAKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataagattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacaattaaagaaatcaaa
gttgctgaaggtacagttgctacagttggacaagtactagtaacatttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaatccacagaatca
actccagcacccgcacaagctagcggaaaaggaatttttgaattcaaattaccagatatt
ggtgaaggaattcatgaaggcgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtacaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggaactgttaaagatattttagttagtgaaggtacagtagcgacagttggt
caagtattagtaacatttgaaggcgattttgaaggagaagctagtcatgaatctactcca
gaatccccagcagaagaagctgaacttacaaacaacgatgcaacttccgctccagctaca
ggtggaaacggaactccatcatctaaaaaagatcctaatggccttgtaattgcaatgcct
tctgtacgtaaatatgctcgtgaaaaagacgttaatatcgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagctgatatcgatgctttcctaaacggcgaacaaccagct
gcagcaacaactactgctcaaacagaagaaaaagcagcagcaccaaaagcagaaaaagca
gcagcaaaacaaccagttgcaagctccgatgcttacccagaaacacgcgaaaaattaaca
ccaactcgtcgtgcgattgcaaaagcaatggtaaactcaaaacatacagcaccacacgtt
actttaatggacgaaatcgaagtaactgcacttatggctcaccgcaaacgtttcaaagaa
gtagctgccgaaaaaggtatcaaacttactttcttaccttatatggtgaaagctcttgtt
gcaacgcttcgtgacttcccagtgcttaacacaactttagatgatgcgacagaagaactt
gtttacaaacattacttcaacgttggtatcgcagcagatacagaccacggtttatacgtg
ccagtaattaaaaatgctgataaaaaatccgtattccaaatttctgatgaaatcaacgaa
ctagctggaaaagcacgtgatggtaaattaacagctgacgaaatgcgccacggttccgca
actatttctaatatcggttctgccggcggacaatggttcactccagtaattaattaccca
gaagttgctatcctaggtgttggtcgtattgctcaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtactagcgctttccttgagctttgaccaccgtgtaattgacggc
gcgactgctcaaaaagcaatgaacaatattaaacgtttattaaacgacccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system