KEGG   Listeria innocua: lin1070Help
Entry
lin1070           CDS       T00067                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lin  Listeria innocua
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lin1070
   00052 Galactose metabolism
    lin1070
   00500 Starch and sucrose metabolism
    lin1070
   00520 Amino sugar and nucleotide sugar metabolism
    lin1070
Enzymes [BR:lin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     lin1070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1095229..1096116)
Genome map
AA seq 295 aa AA seqDB search
MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVASGIEDILIVTGKGK
RAIEDHFDSVPELENNLREKNKLELLHLVEQTTNINLHFIRQAKPKGLGDAILQAKGFVG
NEPFIVMLGDDIVESKIPCSKQLMNQYEKTHSSVIGVQTVPHEETYRYGIIDPINEYDKN
LYNVKGFVEKPDPAKAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEVQ
RVFAYDFEGERFDVGDKFGFIQTTMQFALKHPEIKEDVKALIDDLYQQVHKNDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaagctgtaatcccagctgctggattaggaacacgctttctaccagca
actaaagcaatgcctaaagaaattttacctatcgtggataaaccaactattcaatacata
gtggaagaggctgttgcctcgggtatagaggatatcttaatcgtaactggtaaaggaaaa
cgcgctatcgaagaccatttcgattccgtgcctgaacttgagaataatttgcgtgaaaaa
aacaaattagagttattacatcttgtagagcaaacaactaacattaacttgcactttatc
cgtcaagcaaaaccaaaaggacttggtgatgccatccttcaagcaaaaggttttgttggg
aatgagccatttatcgttatgttaggtgatgatattgtagaatccaaaatcccttgttcc
aaacaattgatgaatcaatacgaaaaaacacatagttctgtaattggcgtacaaactgtg
ccacatgaggaaacatatcgttacggtattattgatccaattaatgaatacgataagaat
ttatacaatgtaaaaggttttgttgagaaaccagatcctgccaaagcaccatccgattta
gcaattctcggtcgttacctactaacaccacaaatttttgacttcttagaaacccaaaag
cctggtgcaggcggcgaaatccaattaacagacgcaatcaatagcctaaatgaagtacaa
cgcgtatttgcttatgactttgaaggcgaacgttttgacgttggcgataaattcggtttt
attcaaactacaatgcaattcgcgctaaaacatccagaaatcaaagaggatgtcaaagca
ttaattgatgatttatatcaacaagtgcataaaaacgataaaaaataa

DBGET integrated database retrieval system