KEGG   Listeria innocua: lin1606Help
Entry
lin1606           CDS       T00067                                 

Definition
(GenBank) lin1606
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lin  Listeria innocua
Pathway
lin00010  Glycolysis / Gluconeogenesis
lin00030  Pentose phosphate pathway
lin00051  Fructose and mannose metabolism
lin00052  Galactose metabolism
lin00680  Methane metabolism
lin01100  Metabolic pathways
lin01110  Biosynthesis of secondary metabolites
lin01120  Microbial metabolism in diverse environments
lin01130  Biosynthesis of antibiotics
lin01200  Carbon metabolism
lin01230  Biosynthesis of amino acids
lin03018  RNA degradation
Module
lin_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lin1606
   00030 Pentose phosphate pathway
    lin1606
   00051 Fructose and mannose metabolism
    lin1606
   00052 Galactose metabolism
    lin1606
  Energy metabolism
   00680 Methane metabolism
    lin1606
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    lin1606
Enzymes [BR:lin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lin1606
Protein phosphatases and associated proteins [BR:lin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     lin1606
Messenger RNA biogenesis [BR:lin03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     lin1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAC96837
Pasteur: LIN01606
UniProt: Q92BE4
Position
complement(1614680..1615639)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENNIGEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgcgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaattagaattaggttcagttggtgattta
cttcaccgtgggggaactttcctctattctgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcttagttgttatc
ggtggagatggttcttatcacggcgcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaacaattgataatgatatttctggaactgattttactattggttttgat
acagcgctaaacactgtgcttgatgcacttgataaaatccgcgatacagcgacaagtcat
gaacgtactttcattattgaagttatgggtcgtgacgcaggtgatatcgcactttggtct
ggccttgctggtggcgctgaagctatcatcgttccagaagaaagctttaacatggacgat
gttgtggatcgtttaaacaaaggtcgcgaacgtggtaaaaaacatagtattattgtagtt
gctgaaggagttatgtctggtaacgagtttgccaaacaactagctgaatatggcgattat
catgcacgtgtaactgttcttggacatgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagtcgtcttggtgcgcgctcagtagaattattgctagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaataatattggtgaaatttta
aaagaaaaacacactcttgatcaaaaattatttgatcttgcatctattttgtcgatttaa

DBGET integrated database retrieval system