KEGG   Listeria innocua: lin1772Help
Entry
lin1772           CDS       T00067                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lin  Listeria innocua
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lin00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1769045..1770910)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPGVFKSMLNSVARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQSGHDYTNITDPFYAETKNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLGLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaacagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgcgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgatacagaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgt
cttcgtgggatgtttggttttgttatttgggataaacaagaagaacttgtttacggcgca
cgcgacccattcggcattaaaccatttttctatgcagaagaagacggtaagctatttatg
ggttctgaaaagaaatccattttacatgctttaaaagaaaaagaactagatgaagtttca
ttacaaaactacatgacttatcaattcgttccagaaccagattccttaactaaaaatgta
aaacgcttagaaccaggacatcagttcacgaagaaaattggtcaaccaatggaaattact
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtaatgtatgattctgtaaaaatgcatatgcgctccgatgtaccagttggt
tcattcctatctggcggtattgattcatcgattattgcggcgattgccaaagaataccat
cctgcaattaaaacattttctgttggttttgaacgcgatggtttcagtgaaatcgatgta
gcaaaagaaacagcagataagcttggtgtagaaaatattagttatgttatctcaccggaa
gaatatatgaaagaattaccaaaaattgtttggcatatggatgacccacttgctgatccg
gctgctattccgctttatttcttatcaagagaagcgcgtaaacaagtaacagtagcatta
tcaggtgagggcgcagatgaactttttggcggttataacatttataacgaaccaaattcc
cttgcgatgtttaacaaaatgccaggcgtatttaaatcaatgttaaatagcgtggcgcgt
attatgccagaaggaatgcgtggtaaaagtttcttagaacgcggaacaacaccgatggaa
gaacgttacatcggaaacgccaaaatgttcacagaaaaagaaaaacaaattttacttccg
aaataccaatctggtcatgattatacgaacattacggatccattttatgcagaaactaag
aattatcatcctgtagaaagaatgcagtatattgatattcatacgtggctacgtggagat
attctcctaaaagctgaccggatgacgatggctaattcactggaagttcgtgtacctttc
cttgataaagaagtgtacaatgtagcaagaaatattccagatacaatgaaaacaaccaat
ggaacaaccaaatacatcttacgtaaagcggcagccacttttgtaccagaacacgtactt
aatcgccgtaaactaggattcccagtaccaattcgtcactggctaaaagacgaaatgaac
gcttgggttaaaaatatcattaaagaatcaccaaccgatcatttaattaacaaacaatac
gttctaggcttactagacgatcactgtgccggtaaattcgattacagtcgtaaaatctgg
acagttgttatctttatgatttggtatgatgtatacgtagcagataaatacgattttgga
aaataa

DBGET integrated database retrieval system