KEGG   Listeria innocua: lin1807Help
Entry
lin1807           CDS       T00067                                 

Definition
(GenBank) some similarities to methyl-accepting chemotaxis proteins
Organism
lin  Listeria innocua
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1814546..1815448
Genome map
AA seq 300 aa AA seqDB search
MNVNAETEDATLLLDGLLQNVAIIRFDTNKKVTYANALFAEAMGYTEEEMLQLSHPDLCF
PDFVQTASYKEMWTNLLAGQKFQNKIERKNARGERVWFEATYIPIIREETVVGVAKIATD
ITRREETVHDFASGLKSMATNLKEHSSVGKTRSEALLELVKSITKESNENTDTLHDLQTE
AQNIHGIINTINGIASQTNLLALNAAIEAARAGDAGRGFSVVAEEVRKLSSRVEEAIKEV
EKSVNGITQEINTISSGTERVEAKVEESQEVLILSLEDFSQIESASTALDQNAGAFTKMI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttaatgcggaaacagaagacgcaactctccttctcgatggtttacttcaaaac
gtagcaataattcgttttgatactaataaaaaagtaacttacgctaatgcacttttcgcg
gaagctatggggtatacagaagaagaaatgttgcaattatcgcaccctgacttatgcttt
ccagactttgtacaaactgcgagctacaaagaaatgtggacaaatctactagctggacaa
aaatttcaaaataaaattgaacgaaaaaacgctcgtggcgaacgtgtttggttcgaagcg
acttatatccctattattcgcgaagaaacagtagtcggagttgcaaaaatagcaactgat
attacgagaagagaagaaactgtccatgattttgcctctggtttaaaaagcatggctaca
aatttaaaagaacattccagtgttggaaaaacgcgcagtgaagctctccttgaactcgtg
aaatcaatcacgaaagaatcaaatgaaaataccgatacccttcacgatttgcaaacagaa
gcacaaaatattcacggcattattaatacaattaacggaattgcttctcagaccaattta
cttgccttaaatgcagcaattgaagcagcacgtgctggtgatgctgggcgtggatttagt
gttgtagctgaagaagttcgtaaactttcaagtcgtgtagaagaagcaattaaagaagta
gaaaaaagtgtcaacggtatcacccaagaaattaatactatctcaagtggtacagaacgt
gtcgaagcaaaagtcgaggaaagccaagaagtccttattttatctttagaagattttagc
caaattgaatctgcctctactgccttggatcaaaatgccggtgctttcacaaaaatgatt
taa

DBGET integrated database retrieval system