KEGG   Listeria innocua: lin2047Help
Entry
lin2047           CDS       T00067                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lin  Listeria innocua
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lin00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2061894..2062463)
Genome map
AA seq 189 aa AA seqDB search
MEQIDKQKIADAVKVILEAVGENPEREGLIDTPMRVARMYEEVFAGLKKDPSVHFDTIFE
EQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLARVVDDVSRRPQLQ
ERITTTVAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRS
EVLALIKHN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaatagacaaacaaaaaattgctgacgcagtgaaagttattttagaagcagtg
ggagaaaatccagaacgtgaaggactaattgatacaccaatgcgagtagctcgtatgtat
gaagaagtttttgctggactcaagaaagatccttctgttcatttcgatactatttttgaa
gaacaacatgaagaactagtgcttgtaaaagatattcgtttttcctctatgtgcgaacat
catcttgttcctttttttggcgtagcacatgtggcttatttgcctcaaaatggacgagtt
gcagggcttagtaaacttgctcgtgtagtggatgatgtgagtcgtcgtccgcaacttcaa
gagcgtattactacgactgttgcagaaattatgatggataaattaaaaccactgggagtc
atggtgataatggaagcagagcatatgtgcatgaccatccgtggtgtcaataaacctgga
actaaaacaattacaagcgcagtacgaggcgcttttaaaaatgacgataagcttagaagt
gaagttttggctttaattaagcataattaa

DBGET integrated database retrieval system