KEGG   Listeria innocua: lin2551Help
Entry
lin2551           CDS       T00067                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lin  Listeria innocua
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lin2551 (tpiA)
   01230 Biosynthesis of amino acids
    lin2551 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lin2551 (tpiA)
   00051 Fructose and mannose metabolism
    lin2551 (tpiA)
   00562 Inositol phosphate metabolism
    lin2551 (tpiA)
Enzymes [BR:lin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lin2551 (tpiA)
Exosome [BR:lin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lin2551 (tpiA)
  Exosomal proteins of bladder cancer cells
   lin2551 (tpiA)
  Exosomal proteins of melanoma cells
   lin2551 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2576432..2577187)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VAAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaataaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataatgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggctctatttttacaagaattagttcgtcttactgaaggaactaatcttcgc
gttgctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgacttaggtgtttcttatgttattatcggacactctgaacgtcgtgag
tacttccacgaaacagatgaagatattaacaaaaaagcacacgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagaccaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaactgaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttccacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgcagacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system