KEGG   Listeria innocua: lin2716Help
Entry
lin2716           CDS       T00067                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lin  Listeria innocua
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:lin00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2735182..2735814)
Genome map
AA seq 210 aa AA seqDB search
MKIAAFDIDSQKGFTPLCPDELPVSGGDKIVPELNFMASLATLRIGSKDAHPKNAVWVVD
SKDEMLAELEYPNADRTWVRHCEPGTKGFELLDGLPVVTDYDYFIWKGMEPDIHPYGACY
HDIVEQLSTGVLEYLREQQVDLVLVGGLAFDFCVKTTVIQLSRAGFSVLVYLPATRALSE
QGFDETKEQLANTEKVQLIETREELVAYCQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcagcttttgatattgattcacaaaaaggctttacaccactttgtccggat
gaattaccagtttcgggcggtgacaaaattgtgccggagcttaattttatggcaagtctt
gctactctacgaattggtagtaaagacgcgcatcccaaaaatgccgtatgggtagttgat
tccaaagacgaaatgctggctgaactcgaatatccaaatgcggaccggacttgggttaga
cactgcgaacccggtacgaaaggttttgaattattagacggattgccagttgtgacggat
tatgattactttatttggaaaggcatggagccagacattcatccgtacggcgcttgttat
cacgatattgtcgaacagctttcaacaggtgtactagaatatttaagagaacaacaggtg
gatttagttcttgttggaggtttagcatttgatttttgtgtgaaaactacggttatacag
ttaagtagggcaggcttttctgtattagtttatttaccagcgacacgtgcattatctgaa
caaggttttgatgaaacaaaagagcaattagcgaataccgagaaagttcaacttatcgaa
acaagggaggaacttgtcgcctactgccagtaa

DBGET integrated database retrieval system