KEGG   Listeria innocua: lin2904Help
Entry
lin2904           CDS       T00067                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lin  Listeria innocua
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lin2904
Enzymes [BR:lin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     lin2904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2923435..2924889
Genome map
AA seq 484 aa AA seqDB search
MEHNKLKPFPKDFLWGSASAAYQVEGAWDEDGKGPSVWDEFVRIPGTTFKETNGDVAVDN
YHRYKEDVALMAEQGLKAYRFSVAWSRVIPHGNGEVNEAGLKFYDNLIDELLSYGIEPVV
TLYHWDIPQGLQDEYGGWESRQVIEDFTNYSALLFERFNGRVKYWVTLNEQNVFISHGYK
LAYHPPGVSDDKRMFAANHNANLANASAIAKFRELGISGKIGPSFAYGPSYSIDANPANV
LASENSEEFNAHFWMDVYTWGEYPTATWNWLEEHGLAPEILPGDTELLKKGKPDFMGVNY
YRSMTHAFNGKDGVGSGKMNTTGEKGTSEETGVPGLYKNTNNPYLEKTNWDWDIDPTGLR
IGLRRITNRYKLPIMITENGLGEYDSLTEDHKIHDEYRIEYIRAHALAIQEAITDGVEML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDENDEKELKRYKKDSFYWYKKTIEANGANLVE
EQGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaacataataagttgaaacctttcccaaaagattttctatggggatcagcttctgca
gcgtaccaagtagaaggtgcctgggatgaagatggcaaaggaccatctgtatgggatgaa
tttgttcgtattcctggaacaacattcaaagaaacaaacggagacgtagcggtggataat
tatcatcgttataaagaagatgtcgcgctaatggctgaacagggcctaaaagcatatcgt
ttctctgtcgcatggagtcgcgttatcccgcatggtaacggggaagttaatgaagctgga
ctaaaattctatgataatttgattgatgaacttctttcttatggaattgagccagttgtt
acactttaccactgggatattccgcaagggctgcaagacgaatatggtggatgggagtcg
cgccaagttattgaagatttcactaactactccgcccttctattcgaacgctttaacggc
cgagttaaatactgggtaacacttaatgaacaaaacgtatttatctcacacggttacaaa
ttagcgtatcacccacctggcgtttctgacgacaagcgtatgtttgcggcaaatcacaat
gcgaacttggcgaatgcttctgcaattgctaaattccgcgagctaggtatttctggaaaa
attggaccaagttttgcttacggaccaagttactccatcgatgccaaccccgcgaacgtg
ttagcttctgaaaactccgaagaattcaatgcccatttctggatggatgtttacacatgg
ggtgaatatcctaccgctacttggaactggctggaagagcacggtcttgcaccggaaatc
ttaccaggcgatacggagcttctgaaaaaaggaaaacctgatttcatgggagttaactat
taccgctcaatgactcatgcgtttaatgggaaagacggcgttggttctgggaaaatgaat
acaactggcgaaaaaggcacttccgaggaaactggtgtaccggggttatacaaaaacacc
aataatccatacttagaaaaaacgaattgggactgggacattgatccaactggcttgcgc
attggcttacgtagaattactaaccgctataaattaccaatcatgattacagaaaatggt
cttggtgagtatgatagcttgacggaagaccacaaaatccatgatgagtaccggattgaa
tacattcgcgcccatgctctagcaatccaagaagcaattactgacggtgtagaaatgcta
ggttactgcacttggagcttcacagatttactaagctggctaaacggctaccaaaaacgt
tacggtttcgtatatgttgaccgcgacgaaaacgatgaaaaagaattaaaacgctataaa
aaagacagtttttactggtataaaaagacaatcgaagcaaacggagctaatttagtagaa
gaacagggcaaataa

DBGET integrated database retrieval system