KEGG   Lawsonia intracellularis PHE/MN1-00: LI0117Help
Entry
LI0117            CDS       T00354                                 

Gene name
cysG
Definition
siroheme synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LI0117 (cysG)
Enzymes [BR:lip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     LI0117 (cysG)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LI0117 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147699..149210
Genome map
AA seq 503 aa AA seqDB search
MKVYLIGAGPGDPGLLTVKGKEILQQADVIMYDFLVNEILLNYAKPDAEIIYVGKKGNSS
YTSPQDEITQLLITKAKEGKIIARLKGGDPYIFGRGAEEAEALVLAGIPFEEIPGITSTI
AAPAYAGIPLTHRDYTSSVTFITGHEDPDKIDSAHNWSALAHSANTLVFVMGMKNLPEIS
KNLIQAGLSPDTPAALIFWGTTAKHKSLASTVKNLPEEAKKNGFTNPSIIVIGKVVTFHS
TLNWFEQKPLLGKSIVVTRAREQASSLARLLTELGAEVIQFPTIDITPVTETATIDQYVH
KIKEYDWIIFTSVNGVRFFWERLIAFKLDARVFAGVSIVAIGPATAEAIREKGIQPDFVP
EEYIAESIADGLVKLGVKGKRILLPRAQEAREVLPNKLREAGATVDIVPVYETRLAIKLQ
DNILQLLEQGTLDCITFASSSTVENFFEHIPITVLKKYRLPKFATIGPVTSNTLKKYGFE
YDIQPTKYTIPDLVNAIADTYKG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatatctcattggagcaggaccaggtgatcctggtttacttacagttaaggga
aaagaaatattacagcaagctgatgttattatgtatgattttttagttaatgaaatcctg
cttaactatgcaaaaccagatgctgaaattatttatgttgggaaaaaaggtaattcatca
tatacctcacctcaagatgaaataacacaattacttataactaaggcaaaagaaggaaaa
ataatagcacgattaaaaggaggagatccatatatttttggtagaggtgctgaagaagct
gaagcacttgttttagctggtattccgtttgaagaaatacctggtataacaagtaccatt
gctgcacctgcatatgcaggtattcctttaacacatagagattatacatcgtcagtaaca
tttattacaggacatgaagatcctgataagattgattcagcccataattggtctgcatta
gctcatagtgcgaatacattagtttttgtgatgggcatgaaaaatcttcctgagatttca
aaaaatttaatacaagcaggattatctcctgatacaccagcagcacttattttttgggga
acaacagcaaaacataagagtttagcttctacagttaaaaatctccctgaagaagcaaaa
aagaatggttttacaaatccttctattattgtcataggtaaggttgttacatttcatagt
acattaaattggtttgaacaaaaaccattattaggaaaaagtattgttgttactcgtgca
agagagcaggcaagttctttagcaaggctacttactgaattaggagctgaagttattcag
tttcctacaattgatataacaccagttacagaaacagctacgattgatcaatatgtacat
aaaataaaagaatatgattggattatctttacttcagtaaatggtgttcgatttttttgg
gaacgtcttatagcttttaaattagatgcaagggtatttgcaggtgtgagtattgtagct
attggacctgctacagcagaagctataagagaaaaaggaattcagcctgactttgttcca
gaagaatatattgcagaaagtattgcagatggattagtgaaacttggagttaaagggaaa
cgtattttactcccaagagcacaagaagcacgagaagttcttcctaacaagttacgcgag
gctggagcaacagttgatattgtcccagtttatgaaacacgtcttgctattaaacttcag
gataatatattacaactcttagaacaaggaacgttagattgtattacttttgcttcttct
tcaacagtagagaatttttttgaacatattcctataactgtgctaaaaaaatatcgtctt
ccaaaatttgcaactattggtccagtgacatctaatacattaaaaaaatatggatttgag
tatgatatacagccaacaaaatacacgattcctgatttagttaatgctatcgctgatacc
tataaaggttaa

DBGET integrated database retrieval system