KEGG   Lawsonia intracellularis PHE/MN1-00: LI0205Help
Entry
LI0205            CDS       T00354                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LI0205 (hemB)
Enzymes [BR:lip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LI0205 (hemB)
Exosome [BR:lip04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI0205 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259031..260029
Genome map
AA seq 332 aa AA seqDB search
MNTIFFRGRRLRRSIQVRDLIQETRLHSQDLIMPYFVVDTDNSNFFQPIPSMPNQYQLSL
SNLEKKVDEAINHGLKSVILFGLPKKKDSYATEAYNENGIIQQAIRTLKKKWPSLHVITD
VCLCEYTNHGHCGLLKVEDQCGHVKNDPTLELLTKVAISHAEAGADMIAPSDMMDGRIQA
LRSGLDHAGFIDIPIMSYSAKYASAYYGPFREAAQSAPQVGDRKSYQMDPANTNEALREV
QADISEGADIIMVKPAGPYQDIIRRMYETFPVPIAAYQVSGEYALIKAAGEKGWINEQAV
IMESLIGIRRSGAKLIITYFTEDVLKKRWVDS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatactattttctttcgtggccgtaggcttcgacgttcaatacaagttcgtgattta
atccaagaaactagattgcatagtcaagacttgattatgccttattttgttgttgataca
gataatagtaatttttttcagcctataccttctatgcctaatcagtatcagctttcactt
tctaatcttgaaaaaaaagttgatgaagcaattaatcatggtttaaaatctgttattctt
tttgggttacccaaaaaaaaagattcttatgctacagaagcttataatgaaaatggtatt
atacagcaggcaattcgaactttaaaaaagaaatggccttcattacacgtcatcacagat
gtttgtctttgtgagtatacaaatcatggacattgtggactactaaaagtagaagatcag
tgtgggcatgtaaaaaatgatcctacccttgaattattaactaaagttgctatcagtcat
gctgaagctggtgcagacatgatagctccatctgatatgatggacggtcgaattcaagcg
ttacgttctggattagatcatgctggttttatagatatacccattatgtcttattctgca
aaatatgcgtcagcttattatggtccatttagagaagctgctcaatctgctcctcaagta
ggtgatcgaaaaagctatcagatggatcctgcaaatacaaatgaagcacttcgtgaagtt
caagctgatattagtgaaggtgcagatattattatggttaaacctgcagggccatatcaa
gatatcatccgacgcatgtatgagacatttcctgttccaatagcagcatatcaagtaagt
ggtgaatatgcgcttattaaggctgcaggagaaaaaggctggatcaacgaacaagctgtt
attatggaatcccttataggtattcgtcgttctggtgcaaaattaataataacgtacttt
actgaggacgttctaaaaaaaaggtgggtagattcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system