KEGG   Lawsonia intracellularis PHE/MN1-00: LI0240Help
Entry
LI0240            CDS       T00354                                 

Gene name
folk
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LI0240 (folk)
Enzymes [BR:lip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LI0240 (folk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
299096..299647
Genome map
AA seq 183 aa AA seqDB search
MLKCMKKILKINSNMTNYKTSYISLGTNLGNLDDNLKEARIRLNTNNKIILNRISPVYNT
EAQDNCNQPWFKNQIIQLATIDLTPHELLDILLNIETSMGRIRSNDPEQRYGPRCIDLDL
LLYEQETYNDKKLCLPHPRMLQRAFVLVPLYDINPALAFPNGQTLKEALKNISYRVEDNF
IYQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaaatgtatgaagaaaatactaaaaataaattctaacatgactaactataaaaca
tcatatataagtctaggaacaaatctaggtaaccttgacgacaatctaaaagaagcaaga
attagactaaatactaataacaaaattatacttaataggatatcccctgtctataacaca
gaagcccaagataattgtaatcaaccatggttcaaaaaccaaatcatccaattagccaca
atagatctgacacctcatgaactgttagatatacttctaaatatagaaaccagtatggga
cggatacgaagcaatgatccagaacaacgttatggtccaagatgtattgatttagattta
ttattatacgaacaagaaacttataatgataaaaaactttgcttacctcatccaagaatg
ctgcaacgtgcctttgtacttgttcctctctatgacattaatccagcacttgcatttccg
aatggacaaacgctaaaagaggcattgaaaaatatttcatatagagtagaggataatttt
atctaccaataa

DBGET integrated database retrieval system