KEGG   Lawsonia intracellularis PHE/MN1-00: LI0287Help
Entry
LI0287            CDS       T00354                                 

Gene name
recD
Definition
(GenBank) ATP-dependent exoDNAse (exonuclease V), alpha subunit-helicase superfamily I member
  KO
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lip00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LI0287 (recD)
Enzymes [BR:lip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LI0287 (recD)
DNA repair and recombination proteins [BR:lip03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LI0287 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(358069..360267)
Genome map
AA seq 732 aa AA seqDB search
MAQLDIKEQIVLQGILDRIVFHNSENGYTVFRLKPENSDDIDTVPVVGYLNNPQPGASIL
VSGQWVNNTRFGRQFQMSTFEIRLPASVEGIKRYLSSGLIKGIGKKTAESIVTEFGEETF
HILDTSPEELLKIKGITKKKLDQITECWQEHQTTRELMVFLQPYGISVTYAVKIYKYYGQ
QSLNIVKENPYRLAMDIHGIGFLTADALATKLGFEKDNPLRAQAGILYTLLKCMDEGHVY
YPKEAFIELTSHNLGIDHQCIEDAIEHLKREERIVCEALDEHIGIYLNRYHHYESQIAFY
LQRILHSPKSVQFKNTDDTISQVINKLNITLAPEQMSAIVTSTTSKIMILTGGPGTGKTT
VLNAIIQVFKENKAKILLAAPTGRAAKRMSEAIGMEARTIHRLLEYSPRNDGFIRNEDMP
LACGLLVVDEASMMDIMLTYHLLKAIPLGATVIFVGDIYQLPSVGPGNVLKDLIISQLLP
VVELTEVFRQAAESQIVCNAHLMNKGEVPCLESSKEALSDFYFIRQSDPDKAADLIVDLV
KNHIPRRFKFDPINDIQVLTPMHKGTVGAASLNKRLQEELNPTSQFLQRGEKIYRLGDKV
MQIRNNYEKDVFNGDIGRITYIDMEEKSIVVNFDERLVSYPSDELDELVAAYAISIHKSQ
GSEYPAVVIPLMTQHYVLLQRNLVYTGVTRGKNLVVFVGESKALAIAIKNNKTQKRHTWL
SARLVNGMLQKL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattagatataaaagagcagatagtactgcaaggtatacttgatcgaattgtt
tttcataattcagaaaatggatatacggtattccgccttaaaccagagaactcagatgat
attgatacagtacctgttgttgggtatttaaataatcctcaaccaggcgcttcaatactt
gtttctggacaatgggtgaataatacacgttttgggagacaatttcagatgtcaacattt
gaaattcgtcttcctgcttcagtagaaggcattaagcgatatctttcttcaggtttgatt
aaaggtataggtaaaaaaacagctgagagtattgttacagagtttggagaagaaacattt
catatattagatacctctcctgaagaacttcttaaaataaagggtattacaaagaaaaaa
ttagatcaaattactgagtgttggcaagaacatcagacaactcgagaactaatggtgttt
cttcaaccttacggtattagtgttacttatgcagtaaagatatataagtattatggtcag
cagtctttaaatatagtaaaagaaaatccttatagattagcaatggatattcatggaata
gggtttcttacagcagatgcactagccacaaaattaggatttgaaaaagataatcctttg
cgagcccaagcaggaatattatatactcttttaaagtgtatggatgaaggacatgtttat
tatccaaaagaagcttttatagagcttactagtcataatcttggtattgatcatcagtgc
atagaggatgctatagaacatcttaagagagaagaaagaattgtttgtgaagcattggat
gaacatattggaatttatttaaatcgctatcaccattacgaatctcaaattgcgttttat
ttacagcgaattctacattcaccaaaatcagtacaatttaaaaatacagatgataccatt
tcacaggttatcaataaacttaatatcactctagctccagaacagatgagtgctatagta
acgtctactacatcaaagattatgatccttacaggaggtcctggtacaggaaagacaact
gtacttaatgcaattatccaagtatttaaagagaataaagctaaaatattacttgcagca
ccaactggacgagcagcaaaacgtatgtcagaagctattggaatggaagcaagaacaatt
catcgtttgttagagtatagccctagaaatgatggctttattagaaatgaagatatgcca
ttagcctgtggtttattagtagtcgatgaggcttctatgatggacattatgcttacttac
catttattaaaggctattccattaggtgctactgttatttttgttggtgatatctatcaa
cttccttctgttggtccaggtaatgtacttaaggatcttattatatctcagctgcttcct
gttgtagaacttacagaagtttttcgacaagcagcagaaagtcagattgtatgtaatgca
catctaatgaataaaggagaagttccttgccttgaatcatcaaaagaggctctttcagac
ttctattttatacgtcaatctgatccagataaagcagctgatctcattgtagatcttgta
aaaaatcatataccaagaagatttaagtttgatcctattaatgatattcaagtattaact
cctatgcataaaggaacagtaggtgctgcaagtttaaataaaagattacaagaagaactt
aatcccacatctcagtttttacagagaggagaaaagatatatcgccttggtgataaagtt
atgcaaatcagaaataattatgaaaaagatgtgtttaatggagatataggcagaattaca
tatattgatatggaagaaaaaagtattgtggttaattttgatgaacgacttgtttcttat
cctagtgatgaacttgatgaacttgttgcagcttatgctatttcaattcataaatctcag
ggttctgaatatcctgcagttgttattcctcttatgacacaacattatgtccttcttcag
agaaatctagtttatacaggtgttacacgtgggaaaaatcttgttgtatttgttggtgag
tcaaaggcattagctatagctataaaaaataataaaactcaaaaaagacatacttggctt
tcagcaagactggtaaatggaatgttacaaaaactataa

DBGET integrated database retrieval system