KEGG   Lawsonia intracellularis PHE/MN1-00: LI0310Help
Entry
LI0310            CDS       T00354                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00230  Purine metabolism
lip01100  Metabolic pathways
Module
lip_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LI0310 (gmk)
Enzymes [BR:lip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LI0310 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 Thymidylate_kin AAA_18 Rad17 AAA_16 RsgA_GTPase MobB AAA_28 ABC_tran AAA_33 AAA_24 AAA_19 AAA_30 AAA PRK
Motif
Other DBs
NCBI-ProteinID: CAJ54366
UniProt: Q1MRL0
Position
390597..391235
Genome map
AA seq 212 aa AA seqDB search
MTKESSVLNHKASGTALVICAPSGTGKTTLIQRLRKEFPCFAYSISCTTRPPRKNEEDGK
DYYFISQEEFIARKNEKYFAEWAYVHGYFYGTPLAPILTILNNGQDILFDIDVQGAAQLY
LTLPYAKYIFLLPPTMVELEKRLRSRGTDREDIIQHRLLSATQEIRQAHWFDTWIVNENI
DKAYDELRATYLASKLSPKFQPTLITSILEGW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaaagttctgttttaaaccataaagcttctggaactgctttagtaatatgt
gctccttctggaacaggcaaaacaacacttattcaaaggcttagaaaagaatttccctgt
tttgcctattctatctcctgtacaacacgccctcctcgtaaaaatgaagaagatggtaaa
gattactatttcattagccaagaagaatttatagctcgaaaaaatgaaaaatatttcgcc
gaatgggcttatgttcatggatacttttatggaactcctcttgctccaatacttactatt
cttaataatgggcaagacattctatttgatatagatgtacaaggagccgcacaactctac
cttactttaccatatgctaagtatatctttcttcttcccccaaccatggttgagcttgaa
aaacgattacgctcacgtggaactgatcgagaagatattatccaacatagacttctttct
gcaactcaagaaatacgacaagcacactggtttgatacctggatcgtcaacgaaaacatt
gataaagcatatgatgaactaagagctacttatttagcatccaaattatctccaaagttt
caaccaactcttattacatctatcttagaaggatggtaa

DBGET integrated database retrieval system