KEGG   Lawsonia intracellularis PHE/MN1-00: LI0375Help
Entry
LI0375            CDS       T00354                                 

Gene name
pcm
Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Brite
Enzymes [BR:lip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LI0375 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(466089..466769)
Genome map
AA seq 226 aa AA seqDB search
MLRYHTSKNNFPLASDLRRQRERMVITQLEQRGITNSYVLTAMRNVHRHLFVPEALQSRA
YDDYPLPIGYGQTISRPYIVAIMTSLLEPTPGLSVLEIGTGSGYQTAILANIGLEVFSLE
RVRELYFQTKELFFLLGYRKIRTCLSDGTLGWEEHAPFDRIIVTAGGPNIPLPLLNQLGD
PGVMVIPVGQNPREQELMCITKKNNTVTSTVIGNVAFVDLVGDYGW
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttgagataccatacatcaaaaaataattttcctttggctagcgatttgaggcgtcag
cgtgagcgtatggttattacacaacttgaacaaagaggaattactaactcttatgttctt
acagcaatgcgtaatgtacatcgacacttatttgttcctgaagcattacaaagtcgtgca
tatgacgactatcccctccctataggttatgggcaaactatttctcgtccatatatcgtt
gctattatgactagcctccttgagccgactccaggtttaagtgtccttgagatcggtact
ggttctggttatcagacagctatcttagccaatataggtcttgaggtatttagtctagaa
cgtgttagggagttgtattttcaaacaaaagaattattttttttgttaggatatagaaaa
attagaacttgcctttctgatgggaccttagggtgggaggaacatgctccctttgataga
attattgttactgctggtggtccaaatatccccttaccattacttaatcaactaggagat
ccaggagttatggttattcctgtcggtcaaaacccacgagaacaagagttgatgtgtata
accaaaaagaataacactgttacatcaacagttattggtaatgttgcttttgttgacctt
gtgggagattatggttggtaa

DBGET integrated database retrieval system