KEGG   Lawsonia intracellularis PHE/MN1-00: LI0410Help
Entry
LI0410            CDS       T00354                                 

Gene name
trpA
Definition
bifunctional tryptophan synthase TRPB
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lip01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lip00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lip00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(504438..505217)
Genome map
AA seq 259 aa AA seqDB search
MIKAAFDNYKSIFIPFIMGGHPNLEVSTKAIMALARAGADIIELGVPFSDPIADGPVNQR
AAEVAMGNGMNFGEVLKQVQVIRGMGCKTPIILFTYLNPILAFGYDKFLHQAKAAGVNGV
LIIDLPPEEGEDFYAMLQEVGLEIVLLVSPTTDLARLPIYITLQPSFIYYISRLSVTGIQ
QDLSNTLEEELYSLCKALPNTKIAVGFGISSIDQARYVSQIADGVIIGSKLVSILETSGV
GVFEDKAREFADIIHGGKL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagcagcatttgacaactacaagtctatatttatcccatttattatgggtgga
caccctaatttagaagtgtcaacaaaagctattatggcccttgcacgagctggtgctgac
ataatagagcttggggtgccattttctgatcctattgctgatggccctgtaaatcaaaga
gccgctgaggtagctatgggaaatggtatgaactttggtgaagtattaaaacaagtacaa
gtaataagggggatgggttgcaaaacgccaatcatactttttacttaccttaatcctatc
ttggctttcggctacgataaatttcttcaccaagctaaagcagctggggtaaatggagtg
ctaattatagaccttcctccagaagaaggagaggatttttatgctatgcttcaagaggtt
gggttagaaattgtgttgcttgtatcgcccacaacagatctagcaaggctaccgatttat
ataacgctccagccaagttttatttattatatctcaagactttctgtaacaggtatccaa
caagatttatcgaatactttagaagaggagttgtatagtttatgtaaggccttacctaat
acaaaaatagcagtaggatttggcatatcatccatagaccaggccagatacgtgagtcaa
attgctgatggtgtgattatagggagtaaactggtttcaatacttgaaacctccggggta
ggtgtattcgaagataaagcaagagaatttgcggatattatacatggaggtaagttatga

DBGET integrated database retrieval system