KEGG   Lawsonia intracellularis PHE/MN1-00: LI0410Help
Entry
LI0410            CDS       T00354                                 

Gene name
trpA
Definition
(GenBank) bifunctional tryptophan synthase TRPB
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00260  Glycine, serine and threonine metabolism
lip00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lip01100  Metabolic pathways
lip01110  Biosynthesis of secondary metabolites
lip01130  Biosynthesis of antibiotics
lip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LI0410 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LI0410 (trpA)
Enzymes [BR:lip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LI0410 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB DsbD His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: CAJ54465
UniProt: Q1MRB1
Position
complement(504438..505217)
Genome map
AA seq 259 aa AA seqDB search
MIKAAFDNYKSIFIPFIMGGHPNLEVSTKAIMALARAGADIIELGVPFSDPIADGPVNQR
AAEVAMGNGMNFGEVLKQVQVIRGMGCKTPIILFTYLNPILAFGYDKFLHQAKAAGVNGV
LIIDLPPEEGEDFYAMLQEVGLEIVLLVSPTTDLARLPIYITLQPSFIYYISRLSVTGIQ
QDLSNTLEEELYSLCKALPNTKIAVGFGISSIDQARYVSQIADGVIIGSKLVSILETSGV
GVFEDKAREFADIIHGGKL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagcagcatttgacaactacaagtctatatttatcccatttattatgggtgga
caccctaatttagaagtgtcaacaaaagctattatggcccttgcacgagctggtgctgac
ataatagagcttggggtgccattttctgatcctattgctgatggccctgtaaatcaaaga
gccgctgaggtagctatgggaaatggtatgaactttggtgaagtattaaaacaagtacaa
gtaataagggggatgggttgcaaaacgccaatcatactttttacttaccttaatcctatc
ttggctttcggctacgataaatttcttcaccaagctaaagcagctggggtaaatggagtg
ctaattatagaccttcctccagaagaaggagaggatttttatgctatgcttcaagaggtt
gggttagaaattgtgttgcttgtatcgcccacaacagatctagcaaggctaccgatttat
ataacgctccagccaagttttatttattatatctcaagactttctgtaacaggtatccaa
caagatttatcgaatactttagaagaggagttgtatagtttatgtaaggccttacctaat
acaaaaatagcagtaggatttggcatatcatccatagaccaggccagatacgtgagtcaa
attgctgatggtgtgattatagggagtaaactggtttcaatacttgaaacctccggggta
ggtgtattcgaagataaagcaagagaatttgcggatattatacatggaggtaagttatga

DBGET integrated database retrieval system