KEGG   Lawsonia intracellularis PHE/MN1-00: LI0413Help
Entry
LI0413            CDS       T00354                                 

Gene name
trpC_2
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lip01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lip00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(506982..507704)
Genome map
AA seq 240 aa AA seqDB search
MPDSLVEMPNTLDFCKIFTTSSKPIIISEVKFSSPSCGQIYQGKLNHVDIAGDYLNSGAA
ALSVLAEPDYFQGSISFIKDIRGAHLNSYILLKDFVLSKKQIAQGLLYGANAVLLIVAFL
NKDLLKELYDYSLDLGLTPIIEVHDGFELEQALQLSPQIIGINNRNLQTLEISLDTAWNL
IKYIPNDCYAICESGIDNATQIREMMDIGFDGFLIGSSLMKYENPGVELQKLISEVCNKS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatagcctcgtagaaatgccaaatacactagatttctgcaagatattcaccacc
tcttcaaaacctatcattattagtgaggtaaaattttcaagtccttcttgtgggcagata
tatcaaggtaaactaaaccatgtcgatattgccggagattatcttaattcaggtgctgct
gctctttcagtattagctgaacctgactatttccaaggcagcatatctttcattaaagat
atcagaggtgctcatcttaattcttatatattactcaaagactttgttttaagcaaaaaa
cagattgcacaagggcttttatatggtgctaatgccgtattgcttattgtggccttcttg
aataaagatttattaaaagagctttatgattattctttagatttaggccttacaccgatt
atagaagtgcatgatggttttgagttagaacaagctttgcagctttctcctcaaattatt
gggattaataatcggaatttacaaacattagaaatcagtttggataccgcttggaacttg
ataaagtatataccaaatgattgttatgctatatgtgaaagtgggatagataatgccact
caaattcgagagatgatggatattggatttgatggatttctaattggttcgtccttgatg
aaatatgagaatcctggagtcgaactacaaaaattgatatctgaggtgtgtaataaaagc
taa

DBGET integrated database retrieval system