KEGG   Lawsonia intracellularis PHE/MN1-00: LI0609Help
Entry
LI0609            CDS       T00354                                 

Gene name
rpiB
Definition
ribose 5-phosphate isomerase RpiB
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LI0609 (rpiB)
   01230 Biosynthesis of amino acids
    LI0609 (rpiB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LI0609 (rpiB)
   00051 Fructose and mannose metabolism
    LI0609 (rpiB)
Enzymes [BR:lip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     LI0609 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752940..753368)
Genome map
AA seq 142 aa AA seqDB search
MLKVYIASDHAGFSLKNTLIEQLQDNDYIVRDLGPMTSEPCDYPLYAQYVCEQVLDEIGS
FGILICGTGIGMSMAANRIKGIRAALCTSEFQARATRLHNNANILCLGERVIGKSIAIEI
VNIFLTTPFEGGRHLQRIASFD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaagtttacattgcttctgatcatgcaggattttctttaaaaaatactcttata
gagcaattgcaagataacgattatatagtaagagatttaggtccaatgacatctgaacct
tgtgattaccctttatatgctcaatatgtttgtgaacaagtattagatgaaataggcagt
tttggtattttaatttgtggaacaggtataggtatgagtatggctgctaaccgtataaaa
ggtattagagcagcactatgtacttctgagttccaagcaagagcaacacgtctacataat
aatgctaatatattatgtttaggtgaacgtgtaataggtaaaagcattgcaatagagatt
gttaatatttttttgacaacaccatttgagggtggacgacatcttcagcgtattgcttca
tttgattaa

DBGET integrated database retrieval system