KEGG   Lawsonia intracellularis PHE/MN1-00: LI0609Help
Entry
LI0609            CDS       T00354                                 

Gene name
rpiB
Definition
(GenBank) Ribose 5-phosphate isomerase RpiB
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00030  Pentose phosphate pathway
lip00051  Fructose and mannose metabolism
lip01100  Metabolic pathways
lip01110  Biosynthesis of secondary metabolites
lip01120  Microbial metabolism in diverse environments
lip01130  Biosynthesis of antibiotics
lip01200  Carbon metabolism
lip01230  Biosynthesis of amino acids
Module
lip_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LI0609 (rpiB)
   00051 Fructose and mannose metabolism
    LI0609 (rpiB)
Enzymes [BR:lip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     LI0609 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: CAJ54663
UniProt: Q1MQR4
Position
complement(752940..753368)
Genome map
AA seq 142 aa AA seqDB search
MLKVYIASDHAGFSLKNTLIEQLQDNDYIVRDLGPMTSEPCDYPLYAQYVCEQVLDEIGS
FGILICGTGIGMSMAANRIKGIRAALCTSEFQARATRLHNNANILCLGERVIGKSIAIEI
VNIFLTTPFEGGRHLQRIASFD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaagtttacattgcttctgatcatgcaggattttctttaaaaaatactcttata
gagcaattgcaagataacgattatatagtaagagatttaggtccaatgacatctgaacct
tgtgattaccctttatatgctcaatatgtttgtgaacaagtattagatgaaataggcagt
tttggtattttaatttgtggaacaggtataggtatgagtatggctgctaaccgtataaaa
ggtattagagcagcactatgtacttctgagttccaagcaagagcaacacgtctacataat
aatgctaatatattatgtttaggtgaacgtgtaataggtaaaagcattgcaatagagatt
gttaatatttttttgacaacaccatttgagggtggacgacatcttcagcgtattgcttca
tttgattaa

DBGET integrated database retrieval system