KEGG   Lawsonia intracellularis PHE/MN1-00: LI0609Help
Entry
LI0609            CDS       T00354                                 

Gene name
rpiB
Definition
ribose 5-phosphate isomerase RpiB
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:lip01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lip01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lip00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lip00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752940..753368)
Genome map
AA seq 142 aa AA seqDB search
MLKVYIASDHAGFSLKNTLIEQLQDNDYIVRDLGPMTSEPCDYPLYAQYVCEQVLDEIGS
FGILICGTGIGMSMAANRIKGIRAALCTSEFQARATRLHNNANILCLGERVIGKSIAIEI
VNIFLTTPFEGGRHLQRIASFD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaagtttacattgcttctgatcatgcaggattttctttaaaaaatactcttata
gagcaattgcaagataacgattatatagtaagagatttaggtccaatgacatctgaacct
tgtgattaccctttatatgctcaatatgtttgtgaacaagtattagatgaaataggcagt
tttggtattttaatttgtggaacaggtataggtatgagtatggctgctaaccgtataaaa
ggtattagagcagcactatgtacttctgagttccaagcaagagcaacacgtctacataat
aatgctaatatattatgtttaggtgaacgtgtaataggtaaaagcattgcaatagagatt
gttaatatttttttgacaacaccatttgagggtggacgacatcttcagcgtattgcttca
tttgattaa

DBGET integrated database retrieval system