KEGG   Lawsonia intracellularis PHE/MN1-00: LI0609Help
Entry
LI0609            CDS       T00354                                 

Gene name
rpiB
Definition
(RefSeq) ribose 5-phosphate isomerase RpiB
  KO
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LI0609 (rpiB)
   01230 Biosynthesis of amino acids
    LI0609 (rpiB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LI0609 (rpiB)
   00051 Fructose and mannose metabolism
    LI0609 (rpiB)
Enzymes [BR:lip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     LI0609 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752940..753368)
Genome map
AA seq 142 aa AA seqDB search
MLKVYIASDHAGFSLKNTLIEQLQDNDYIVRDLGPMTSEPCDYPLYAQYVCEQVLDEIGS
FGILICGTGIGMSMAANRIKGIRAALCTSEFQARATRLHNNANILCLGERVIGKSIAIEI
VNIFLTTPFEGGRHLQRIASFD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaagtttacattgcttctgatcatgcaggattttctttaaaaaatactcttata
gagcaattgcaagataacgattatatagtaagagatttaggtccaatgacatctgaacct
tgtgattaccctttatatgctcaatatgtttgtgaacaagtattagatgaaataggcagt
tttggtattttaatttgtggaacaggtataggtatgagtatggctgctaaccgtataaaa
ggtattagagcagcactatgtacttctgagttccaagcaagagcaacacgtctacataat
aatgctaatatattatgtttaggtgaacgtgtaataggtaaaagcattgcaatagagatt
gttaatatttttttgacaacaccatttgagggtggacgacatcttcagcgtattgcttca
tttgattaa

DBGET integrated database retrieval system