KEGG   Lawsonia intracellularis PHE/MN1-00: LI0735Help
Entry
LI0735            CDS       T00354                                 

Gene name
ychB
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lip00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919170..920087
Genome map
AA seq 305 aa AA seqDB search
MIYSHLSSTSCTITTGCKVNLNLYITGILPNGWHKIDSIFLPLSEPHDELHIEITNHNQG
LHLSCNILDIELENNILTKTYTLFTKATHFTPSISIYLKKGIPYGAGLGGGSSDAAALLT
WLQKNSPLPLSPSKLLKLAAEIGADVPFFLKNKPCRATGIGEKLEEISLSNLNISGNTLF
IICPNLKISTPYAYKMWDDYNKKQIATSSRYNNNLTKKYSWDRSSPSTHLSDYLWMKNDF
EPVIFSEYTELSVFKEQLLQFGARAAVLSGSGSSIYGLFKEYNQTSIMTEFYKKKNILTF
SQLLQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatttattctcacctttctagtaccagttgtacgattactactggatgtaaagtaaat
cttaatctatatattacaggaattcttcctaatggttggcataaaatagactctattttt
ctaccactatctgaacctcatgatgaacttcatattgaaataactaatcataaccaaggg
cttcatctttcctgcaatattcttgatattgagttagagaataatattctgacaaaaact
tataccctttttactaaggctacacattttaccccttctatttctatatatttaaaaaaa
gggatcccttatggagctggtcttggtggtggtagctcagatgctgctgcattactaact
tggttacaaaaaaatagtccacttcccttatctccatcaaaactactaaaacttgctgct
gagattggtgcagatgtcccattttttcttaaaaataaaccttgtcgagctactggcatt
ggagagaagttagaagaaatctctctttctaaccttaatatttcaggcaatacgcttttt
attatttgtccaaacctaaaaatttcaaccccatatgcatataaaatgtgggatgattat
aataaaaaacagatagctacctcctcacgttataacaataacttgacaaaaaaatactct
tgggatagaagctcaccatccacccatctgtcagactacttgtggatgaaaaatgatttt
gagccagttatcttttctgaatacacagaattaagtgtattcaaagaacaactccttcag
tttggagcgcgagctgctgtactaagtggtagtggatcatcaatatatggcttatttaaa
gaatataaccagacgtcaattatgactgagttttataagaaaaaaaatattttaacattc
agtcagttattgcagtag

DBGET integrated database retrieval system