KEGG   Lawsonia intracellularis PHE/MN1-00: LI0738Help
Entry
LI0738            CDS       T00354                                 

Definition
(GenBank) Peptidyl-tRNA hydrolase
  KO
K01056  
peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Brite
Enzymes [BR:lip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     LI0738
Translation factors [BR:lip03012]
 Eukaryotic Type
  Release factors
   LI0738
 Prokaryotic Type
   LI0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
921880..922485
Genome map
AA seq 201 aa AA seqDB search
MSIKGIIAGLGNPGGQYEKTRHNIGFMVINKLITITSASKLSGKKFYCELWKTTTIIDNY
LLAKPQTYMNLSGEAIHPLVEWYNITKDNLLVIHDELDLPIGKMKLQQGGGTAGHNGLKS
IIHNLGTKDFYRLRIGIGRSPLPSENTVNWVLGHLSMKELTTLNNLFPTIFDALSFFIKD
EKETAIRMINSFTLSETVNLS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaagggattattgcaggtcttggtaaccctggaggacaatatgaaaagacc
cgacataatattgggtttatggttattaataaacttattactataacatcagcaagtaaa
ctttctggcaaaaaattttattgtgaattatggaaaacaacaactataatagataattat
ctattagctaaaccacaaacatatatgaatctatcaggagaagctatccatcccctagta
gaatggtataatataaccaaagataaccttttagttatccatgacgaactagacttacct
attgggaaaatgaaacttcaacaaggtggaggaactgcaggtcataatggactaaaatct
attattcataacttaggaaccaaagatttttatcgcctccgaataggcattggtcgttct
cctcttccctctgaaaatacagtaaactgggtccttggccacctttctatgaaagagctt
actactcttaacaatctcttccctacaatttttgatgcactctccttctttatcaaagat
gagaaagagacagctataagaatgattaacagttttactcttagtgaaacagttaactta
agctaa

DBGET integrated database retrieval system