KEGG   Lawsonia intracellularis PHE/MN1-00: LI0918Help
Entry
LI0918            CDS       T00354                                 

Gene name
recR
Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lip00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LI0918 (recR)
DNA repair and recombination proteins [BR:lip03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LI0918 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1147646..1148257
Genome map
AA seq 203 aa AA seqDB search
MDQHIPEILRTVIGQLTKLPGLGPKSAMRIAMTFLKWPESETRSLGKSIYELRDKLGLCS
SCGALSDSNLCFVCADSERLDNLLCIVSEWDSMVTLEEVGFFQGRYMILGGLLAPLDNMG
LDKLEIDRLIDRLNKGEVKEVILALGSTIEAETTATMIYSLISKRFPYIRVTRLAQGIPL
GAEVKFMDRETLRQSLQYRQELS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagcatataccagaaatattaaggactgttataggtcaattaactaaacttcct
ggattagggccaaaatctgctatgcgtattgctatgacgtttttaaagtggcctgaaagc
gaaactcgtagtcttgggaaatctatttatgaattacgagataaactaggactatgttct
tcttgtggtgcactgtcagatagtaacctttgttttgtatgtgcagatagtgaaagatta
gataatcttctttgtattgtttctgagtgggatagtatggtgacattagaagaagttggt
ttttttcaagggcgttatatgattttaggaggattactagcacctcttgataatatgggc
ttagacaaattagagattgatcggttaatagatcgtttaaacaagggagaggtaaaagaa
gtaattcttgcattaggctcaacaattgaggcagaaaccacagctacaatgatttatagt
ttaattagtaaacgtttcccttatattcgagttacaagattagctcagggtatccctctt
ggagcagaagttaaatttatggatagagaaacactgaggcagtcattacaatataggcaa
gagttatcttaa

DBGET integrated database retrieval system