KEGG   Lawsonia intracellularis PHE/MN1-00: LI0970Help
Entry
LI0970            CDS       T00354                                 

Gene name
rplX
Definition
50S ribosomal protein L24
Orthology
K02895  
large subunit ribosomal protein L24
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Ribosome
Brite
KEGG Orthology (KO) [BR:lip00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    LI0970 (rplX)
Ribosome [BR:lip03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    LI0970 (rplX)
  Bacteria
    LI0970 (rplX)
  Archaea
    LI0970 (rplX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201555..1201875
Genome map
AA seq 106 aa AA seqDB search
MQQIRIHKNDKVMVIAGKDKGKIGKVLKVCHKHNRILVEKVNIVKRHVKPNPYRREHGGI
IEKELPIVTSNLMIICSSCTSPTRVHYRYSESGKKLRICKKCNESL
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaatacgcatacataaaaatgataaagtaatggttattgctggcaaagataaa
ggtaaaattggcaaggttcttaaagtttgtcataagcataatagaatactagtagaaaaa
gtaaacatagttaagcgtcatgtaaaaccaaatccatatcgtcgtgaacatggtggcata
atagaaaaagaattgcctatagttacttctaatctaatgattatttgctcttcgtgtaca
tctccaacacgcgtacactatcgttattctgaaagtggtaaaaaattacgtatttgtaaa
aaatgtaatgagtcactataa

DBGET integrated database retrieval system