KEGG   Lawsonia intracellularis PHE/MN1-00: LI1076Help
Entry
LI1076            CDS       T00354                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00010  Glycolysis / Gluconeogenesis
lip00052  Galactose metabolism
lip00500  Starch and sucrose metabolism
lip00520  Amino sugar and nucleotide sugar metabolism
lip00521  Streptomycin biosynthesis
lip01100  Metabolic pathways
lip01110  Biosynthesis of secondary metabolites
lip01120  Microbial metabolism in diverse environments
lip01130  Biosynthesis of antibiotics
lip01200  Carbon metabolism
Module
lip_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LI1076 (glk)
   00052 Galactose metabolism
    LI1076 (glk)
   00500 Starch and sucrose metabolism
    LI1076 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LI1076 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LI1076 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LI1076 (glk)
Enzymes [BR:lip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LI1076 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CAJ55130
UniProt: Q1MPE7
Position
complement(1321808..1322791)
Genome map
AA seq 327 aa AA seqDB search
MHILAADIGGTYSRFALFKDNPLCLIHKEYISSYTTSFTTILQQIMSNSLFASVPLDMCV
LAIAGPIDNQEIVKPSNLPYSIIKKDLLSFCKNILFINDFEAQAWSCLTESMSDAVLLHP
EPKHNSFHNNNNVFSFNNKSGRLGVIGAGTGLGMAVLELDMYGKTKVIASEGGHSAFPFI
TNHELEFGNFLCQKKKLNYARLDDVLSGSGLTWLHLFLTKEQFKPEEITLKPEFIDSETH
TYFSCFYARICRSLALFSLTQQGIVITGGLAKKCQILVNHPSFKKEFVNIGGEHKKILSR
MPIWLNCNDASGLWGAAQAGVIYSSKN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgcatatccttgctgcagatattggtggtacatatagccgttttgctctctttaaagat
aaccctctatgcctaatacataaagagtatatttctagttatacaacttcgtttactact
attctacaacaaataatgtctaattctttatttgcatctgtaccattagatatgtgtgta
ttagctattgctggtccaatagataatcaagaaatagtaaaaccttcaaatcttccatat
tctattataaaaaaagatttattatctttctgtaaaaatattctttttatcaatgacttt
gaagcacaagcctggtcttgtcttacagaaagtatgtcagatgctgttttattacatcca
gaaccaaaacataactcctttcacaataataacaatgtattttcatttaataataagtct
gggaggttaggagtcattggtgcaggtacaggactaggaatggctgttcttgaacttgat
atgtatggaaaaacaaaagttatagcatcagaaggtggacattcagcttttccttttata
acaaaccatgagcttgagtttggaaatttcctttgtcaaaagaaaaaacttaattatgcc
cgattagatgatgttctttcaggatcaggtcttacctggcttcatctttttttaactaaa
gaacagtttaagcctgaagaaattaccttaaaacctgagtttattgatagtgaaacccat
acatacttttcatgcttttatgctcgaatatgtcgctcattggcgttgtttagtctgacc
caacaagggattgtaatcactggtggattagcaaaaaaatgtcaaatattagtcaatcat
ccttcctttaaaaaagaatttgtaaacattggaggagaacataaaaaaatactctctcga
atgccaatttggctcaactgtaatgatgcaagcggactatggggagcagcacaagcaggt
gttatatattcttcaaaaaattaa

DBGET integrated database retrieval system