KEGG   Lawsonia intracellularis PHE/MN1-00: LI1076Help
Entry
LI1076            CDS       T00354                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LI1076 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LI1076 (glk)
   00052 Galactose metabolism
    LI1076 (glk)
   00500 Starch and sucrose metabolism
    LI1076 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LI1076 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LI1076 (glk)
   00524 Butirosin and neomycin biosynthesis
    LI1076 (glk)
Enzymes [BR:lip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LI1076 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1321808..1322791)
Genome map
AA seq 327 aa AA seqDB search
MHILAADIGGTYSRFALFKDNPLCLIHKEYISSYTTSFTTILQQIMSNSLFASVPLDMCV
LAIAGPIDNQEIVKPSNLPYSIIKKDLLSFCKNILFINDFEAQAWSCLTESMSDAVLLHP
EPKHNSFHNNNNVFSFNNKSGRLGVIGAGTGLGMAVLELDMYGKTKVIASEGGHSAFPFI
TNHELEFGNFLCQKKKLNYARLDDVLSGSGLTWLHLFLTKEQFKPEEITLKPEFIDSETH
TYFSCFYARICRSLALFSLTQQGIVITGGLAKKCQILVNHPSFKKEFVNIGGEHKKILSR
MPIWLNCNDASGLWGAAQAGVIYSSKN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgcatatccttgctgcagatattggtggtacatatagccgttttgctctctttaaagat
aaccctctatgcctaatacataaagagtatatttctagttatacaacttcgtttactact
attctacaacaaataatgtctaattctttatttgcatctgtaccattagatatgtgtgta
ttagctattgctggtccaatagataatcaagaaatagtaaaaccttcaaatcttccatat
tctattataaaaaaagatttattatctttctgtaaaaatattctttttatcaatgacttt
gaagcacaagcctggtcttgtcttacagaaagtatgtcagatgctgttttattacatcca
gaaccaaaacataactcctttcacaataataacaatgtattttcatttaataataagtct
gggaggttaggagtcattggtgcaggtacaggactaggaatggctgttcttgaacttgat
atgtatggaaaaacaaaagttatagcatcagaaggtggacattcagcttttccttttata
acaaaccatgagcttgagtttggaaatttcctttgtcaaaagaaaaaacttaattatgcc
cgattagatgatgttctttcaggatcaggtcttacctggcttcatctttttttaactaaa
gaacagtttaagcctgaagaaattaccttaaaacctgagtttattgatagtgaaacccat
acatacttttcatgcttttatgctcgaatatgtcgctcattggcgttgtttagtctgacc
caacaagggattgtaatcactggtggattagcaaaaaaatgtcaaatattagtcaatcat
ccttcctttaaaaaagaatttgtaaacattggaggagaacataaaaaaatactctctcga
atgccaatttggctcaactgtaatgatgcaagcggactatggggagcagcacaagcaggt
gttatatattcttcaaaaaattaa

DBGET integrated database retrieval system