KEGG   Lawsonia intracellularis PHE/MN1-00: LI1099Help
Entry
LI1099            CDS       T00354                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LI1099 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LI1099 (murE)
Enzymes [BR:lip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LI1099 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1351636..1353084
Genome map
AA seq 482 aa AA seqDB search
MNRYPLKALESELEKKHMLICIDSRKVEKGCVFVALPGSSVDGGLFIPDAVSRGAAYIVC
RHNEVEYCGSAIPIVVDDPRYTLGRLARIFYNTGNLSMPIIGVTGTNGKTTITYLLEYLF
RAKGNRTGVIGTIAYRWPGFSKEAPLTTPQCLDLHAMLAQMQVDKTEIVFMEVSSHALDQ
RRIAGISFKGVIFTNLTQDHLDYHKDMKEYFHAKARLFFEYPSKNKIMVASMDNQWGRKL
AKLVPEIIGFGFKNKPTQVSNYLFGKILSSSRAGLHLQMSFKDKVWELCTPLVGVHNAEN
LLAVQAISLQLGLAPEDFCCFEKFTGVPGRLERIVNKKQLDIFVDYAHTPDALINVLSAL
RDVGFKRIITVFGCGGNRDKAKRPLMGKAVAKLSDVAVLTSDNPRNEDPELIMADVLPGL
KKAKQIITEPDREKAIRQAIELVSPGDALLVAGKGHECTQQIGFMKYPFSDQSVIRKILG
CD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatatcctcttaaagcccttgagtccgaactagagaaaaaacatatgctaatc
tgtatagactcacgtaaagttgagaaagggtgtgtttttgttgcacttccaggtagcagt
gttgatggtgggctttttattccagatgctgtttctagaggcgcagcatatattgtttgt
cgccataatgaggtagagtattgtggtagtgcaatacctattgttgtggatgatcctaga
tatactttagggaggttagctaggattttttataatacaggaaatctatccatgccaata
attggagttactggaacaaatggtaaaacaacaattacttatcttttagagtatcttttt
agggcaaaaggaaacaggacaggtgtcattgggacaattgcttatcgctggcctggattt
tctaaagaagcaccacttactacccctcaatgcttagacttacatgcaatgcttgcacag
atgcaggtagataagacagaaattgtgtttatggaagtttcttctcatgctttagatcaa
aggcgaatagcaggtattagttttaaaggggttatttttacaaacttaactcaagatcat
ttagattatcataaagacatgaaagagtattttcatgctaaagcaagacttttttttgaa
tacccatctaaaaataaaataatggtagcatcaatggataatcaatgggggaggaaatta
gcaaaacttgtcccagagataatagggtttggttttaaaaacaaaccaacacaagtttca
aattatttatttgggaaaatactttcttcttctagagccggcttacatctgcagatgagt
tttaaagataaggtttgggaactttgtacacctttagttggagtacataatgctgaaaac
ttgttggctgtacaagcaataagtctccaattgggtttagctcctgaggatttctgttgt
tttgaaaagtttacaggtgttcctggccgtcttgaaagaatagttaataaaaaacaatta
gatatttttgtagattatgcccatactccagatgcacttataaatgtactttctgcctta
cgtgatgttggttttaagcgaattataacagtttttggttgtggtggtaatagagataaa
gcaaaacgtccattaatggggaaagctgttgcaaaactatctgatgtagcagtgttaaca
tcagataatccacggaatgaagacccagagttaattatggcagatgttttaccaggcctc
aaaaaagctaaacaaattattacagaaccagatagagagaaagcaattcgtcaagctata
gaattagtttcacctggagatgcattacttgttgcaggaaaaggccatgaatgtacacaa
caaataggatttatgaaatatccctttagtgatcaaagtgtgatacggaaaattttagga
tgcgattaa

DBGET integrated database retrieval system