KEGG   Lawsonia intracellularis PHE/MN1-00: LI1132Help
Entry
LI1132            CDS       T00354                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LI1132 (tpiA)
   01230 Biosynthesis of amino acids
    LI1132 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LI1132 (tpiA)
   00051 Fructose and mannose metabolism
    LI1132 (tpiA)
   00562 Inositol phosphate metabolism
    LI1132 (tpiA)
Enzymes [BR:lip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LI1132 (tpiA)
Exosome [BR:lip04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LI1132 (tpiA)
  Exosomal proteins of bladder cancer cells
   LI1132 (tpiA)
  Exosomal proteins of melanoma cells
   LI1132 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1390582..1391340)
Genome map
AA seq 252 aa AA seqDB search
MKILIAANWKMNKNRLEAKDMIEKLMSMPEGIPPQRDIVLFPPFLAIDTIKEKLKNSTIV
IGAQNFYPAPSGAFTGEISLEMLKDVGCSWVLIGHSERRHIIGELPTLIEQKTKLALSYG
FSIILCIGETAQEREAGLVNSVLEQQLRTSLTDIPSKAISQLVIAYEPVWAIGTGKVASQ
QDIITAHTLIRKILHNMIGNTSQNIRILYGGSVNSENASSILELDNVNGLLVGGASLQAE
SFMKIIHAGFSE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacttatagcagcaaactggaaaatgaataaaaaccggctagaagcaaaggat
atgattgaaaaacttatgtctatgccagaagggattcctccccaaagagatattgttctt
ttccctccctttcttgctattgatacaataaaagaaaaattaaaaaattctactattgtc
attggagcacaaaatttctatcctgccccttcaggtgcttttacaggagaaatttcttta
gaaatgcttaaagatgtaggctgctcatgggttcttattggtcattctgaacgtcgtcat
attataggtgaactacctacacttattgaacaaaaaacaaaacttgctttatcatatgga
ttttctatcattctatgtattggagaaactgcacaagaacgagaagctggacttgttaac
agtgtgttagagcaacaattgagaacaagccttacagatattccttcaaaagctatttca
caacttgtcattgcatatgaaccagtttgggcaattggtacaggaaaagttgcttctcaa
caagatattataactgcccatactctaataagaaaaattttacataatatgataggtaat
acaagccaaaacatcagaattctatatggtggaagtgtcaactccgaaaatgcttcttct
attctagaacttgacaatgtaaatggtcttctggtagggggtgcttctttacaagcagaa
tcttttatgaaaattatacatgctggattttctgaatag

DBGET integrated database retrieval system