KEGG   Lawsonia intracellularis PHE/MN1-00: LI1137Help
Entry
LI1137            CDS       T00354                                 

Gene name
cheB
Definition
chemotaxis response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:lip02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:lip02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394777..1395850
Genome map
AA seq 357 aa AA seqDB search
MTRVIVVDDSAFFRSSITKMLTQDSEIEVIGVAKDGIEGLEKIKNLKPDVVTMDIEMPKL
DGISTLKIIMDEMPLPVIMVSSLTKEGAEATLKALEFGAVDFIPKYPGNSLASMDLAALS
SDLCTKVKAVAARAKRFPLKRIRKDKVPIISPVKKDFFTSPNHSERSRRDIIAIGVSTGG
PPAVQKVLSELPETFPACILIAQHMPAAFTKPFAERLNSMCKISVKEAEHGNPIKNGIAY
VCPGGRHLRLDLKGALPQISVVSEPSTALYKPSANVLMESVGKSMGGRSVGVIMTGMGSD
GVEGMRVLKSKGGFVIAQSEASCVVYGMPKAIVDGGLADEVVDLDNIAERVASALYK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgacacgtgttattgtagttgatgactctgcattttttagaagctctattactaaaatg
ctaactcaagattcagaaattgaagttattggagttgcaaaagatggtatagaaggtctt
gagaagataaaaaaccttaaacctgatgttgttactatggatattgaaatgccaaaactt
gatggtatttcaactttaaaaattattatggatgaaatgccattacctgtaattatggtc
agttccttaacaaaagaaggagctgaagcaacattaaaagctcttgagtttggagctgtt
gattttatcccaaagtatccaggtaatagcttggcaagtatggacttagcagcactatca
tcagatctgtgtacaaaggtcaaagctgttgcagcacgagcaaaacgctttccattaaag
cggataaggaaagataaagtacctattatctctcctgtaaaaaaagatttttttacatca
cctaatcattcagaaaggtctaggagagatattattgccattggtgtttcaacaggagga
cctccagctgtacaaaaggttctttcagagcttccagaaacatttccagcttgtattctt
attgctcaacatatgccagcagcttttacaaaaccttttgcagaacgacttaacagtatg
tgtaaaatttctgtaaaagaagccgagcatggtaatcctataaaaaatggcatagcttat
gtatgtccgggtggaagacatttacgcttagacttgaaaggtgctttacctcagatttct
gtggtttctgaaccatcaacagctctttataagccatctgctaatgttcttatggagtca
gttggtaaaagcatgggtggaagatctgttggagttattatgacaggtatgggaagtgat
ggggttgaagggatgagagtacttaaatctaaaggaggatttgttattgctcagagtgaa
gcttcatgtgttgtttatggtatgccaaaagcaatagtagatggtggtcttgcggatgaa
gttgttgatcttgataacattgcggaaagggtagcttcggctctttataaataa

DBGET integrated database retrieval system