KEGG   Lawsonia intracellularis PHE/MN1-00: LI1186Help
Entry
LI1186            CDS       T00354                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lip00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LI1186 (ruvA)
Enzymes [BR:lip01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LI1186 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1455153..1455752
Genome map
AA seq 199 aa AA seqDB search
MIAYLEGYIAEFGETSCVVATSSGIGYEVFLTTPTRSTLPNKGEQVRFYICHIVREDIQE
LFGFETWDERQTFIVLTSISKVGARTALNMLSTFRPNDLRQCVIEEDIFALTRVSGIGKK
TAQHIFLELKYKLQIDGNSTTSSSPSIGQSLFYDILTGLQGLGYTKEESSVVIKSVLQHE
PDLDVGSALRRCLKQLVKG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatatcttgaaggatatattgcagagtttggagaaacaagctgtgttgttgct
acctctagtggtattgggtatgaagtttttttaactacacctacacgttcaacattacct
aataaaggagaacaagtacgtttttatatttgtcatattgtacgggaagatatacaagaa
ctgtttggctttgaaacatgggatgagcgacaaacgtttattgttttaacatctatatct
aaagtcggtgcacgtacagcacttaacatgctttcaacttttcgaccaaatgatctaaga
caatgtgttatagaagaagatatttttgctcttactcgtgtatctggaattggaaagaag
acagcacaacatatttttcttgaacttaaatataaacttcaaattgatggaaatagtact
acatcttcttccccttctattggtcaaagtcttttttatgatatattaacaggtcttcaa
ggactaggatatactaaagaagaaagttctgtagttataaagtccgttttgcaacatgaa
ccagatttagatgttggtagtgctcttagaagatgtctgaaacagctggtaaaggggtaa

DBGET integrated database retrieval system