KEGG   Lawsonia intracellularis PHE/MN1-00: LI1186Help
Entry
LI1186            CDS       T00354                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction resolvasome, DNA-binding subunit
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lip00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LI1186 (ruvA)
Enzymes [BR:lip01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LI1186 (ruvA)
DNA repair and recombination proteins [BR:lip03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LI1186 (ruvA)
    RecFOR pathway proteins
     LI1186 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1455153..1455752
Genome map
AA seq 199 aa AA seqDB search
MIAYLEGYIAEFGETSCVVATSSGIGYEVFLTTPTRSTLPNKGEQVRFYICHIVREDIQE
LFGFETWDERQTFIVLTSISKVGARTALNMLSTFRPNDLRQCVIEEDIFALTRVSGIGKK
TAQHIFLELKYKLQIDGNSTTSSSPSIGQSLFYDILTGLQGLGYTKEESSVVIKSVLQHE
PDLDVGSALRRCLKQLVKG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatatcttgaaggatatattgcagagtttggagaaacaagctgtgttgttgct
acctctagtggtattgggtatgaagtttttttaactacacctacacgttcaacattacct
aataaaggagaacaagtacgtttttatatttgtcatattgtacgggaagatatacaagaa
ctgtttggctttgaaacatgggatgagcgacaaacgtttattgttttaacatctatatct
aaagtcggtgcacgtacagcacttaacatgctttcaacttttcgaccaaatgatctaaga
caatgtgttatagaagaagatatttttgctcttactcgtgtatctggaattggaaagaag
acagcacaacatatttttcttgaacttaaatataaacttcaaattgatggaaatagtact
acatcttcttccccttctattggtcaaagtcttttttatgatatattaacaggtcttcaa
ggactaggatatactaaagaagaaagttctgtagttataaagtccgttttgcaacatgaa
ccagatttagatgttggtagtgctcttagaagatgtctgaaacagctggtaaaggggtaa

DBGET integrated database retrieval system