KEGG   Lawsonia intracellularis PHE/MN1-00: LIB007Help
Entry
LIB007            CDS       T00354                                 

Gene name
asnB
Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lip00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2:complement(12772..14652)
Genome map
AA seq 626 aa AA seqDB search
MCGVCGIICLDGDKPSKEVLSHMLDAIRHRGPDKANVVVDGCIALGHCRLAILDLTDAAA
QPMSTSDKLFTIVYNGEIYNFEEIRRELIKLGHTFISRSDTEVILHAYIQWGAQCVTKFN
GMFVFVIYDVIRKQIFIARDRYGIKPLYYTIIQNNFLFSSEAKAFLRYPQFCTKLDYEAL
LEYFTFQNILTDKTLLHNVYIFPPGHYAILPLNTGQLTFSQYWDYCFDESKNIHSDKEYE
EELTYLIQQAVQRQLQSDVELGTYLSGGMDSGSITALASKRFPYIKSFTCGFDLHSISGL
ELAFDERNAAEAMSYLFKTEHYEMVLKSGDMERVFPRLAWHIEEPRTGQSYPNFCIAHLV
SKFVKVVLAGTGSDELFGGYPWRYYRALGEKGENSFEKYIDRYYLFWQRLIPNRYLLSMF
KPIETHVRHVRTRDIFRNIFGDNNSPVTSHEESINRSLYFEAKTFLHGLLVVEDKLSMAH
SLETRLPFLDNDLVDFAMRLPVRCKIHRLNETLRINENESAKASRYYKKTNDGKWLLRRA
MERYVPTHIIEAVKQGFSAPDASWFRGESIDFVHRYLFSQNVRLYEYFDRKVVHELVTEH
LEGNANRRLFIWSLLSFEEWLHQYLP
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggagtttgtggcataatttgtttagatggagacaaaccttcaaaagaagtatta
agtcatatgctcgatgctattagacatcgtggcccagacaaggcaaatgttgtagttgat
ggatgtatagcacttgggcactgtcggctcgcaattcttgatctaacggacgctgcagca
caaccaatgtctacttcagataaactttttactatagtatataatggtgaaatttataac
tttgaagaaatccgacgagagctaataaaattaggacatacatttattagccgtagtgac
acagaagtcattcttcatgcttatattcagtggggagcgcaatgtgtaacaaaatttaat
ggaatgtttgtctttgttatatacgatgttattcgaaaacaaatatttatagctcgtgat
cgttatggtataaaaccattatactatactatcatccaaaataactttttatttagttca
gaggcaaaagccttcttacgttatccacaattctgtacgaaattagattatgaagcccta
ctagaatattttacttttcaaaatattctaacagataaaacattactgcataatgtctat
atattccctcctgggcactatgctattttacctttaaatacaggccaacttactttttca
caatattgggattattgctttgatgaaagtaagaatatccattctgataaagagtatgaa
gaagaattaacatatcttattcagcaggctgtacagcgtcagctgcaaagtgatgttgag
ctaggtacttatttatctggaggaatggattcaggttcaattacagctttagcttctaaa
cgtttcccatatattaaatcatttacttgtggctttgatctccattccatttcagggtta
gaacttgcttttgatgaacgtaatgcagcagaagcaatgtcttatctattcaaaacagaa
cactatgaaatggtcctaaaatctggagatatggaacgagtatttcctcgtttagcttgg
catatagaagaaccacggacaggacaaagttatcccaatttttgtatagcacacctggtc
tcaaaatttgttaaagttgttctagctggtactggtagtgatgaactttttggtggatat
ccttggcgttattatagagctcttggagaaaaaggagaaaatagttttgaaaagtatatt
gatcgttattatttattctggcaacgacttatacctaatcgatatctactaagcatgttc
aaacctattgaaactcatgttcgtcatgtacggacacgtgatatttttcgtaatatattt
ggtgataataattctcctgtaaccagtcatgaagaaagtattaatcgttccctctatttt
gaagctaaaactttcttacatggattactagttgtagaagataaactttctatggcacac
agtttggaaacacgccttccatttcttgataatgaccttgttgattttgctatgcgttta
cctgtaaggtgtaaaattcatagactcaatgaaacattaagaatcaacgaaaatgaatca
gctaaagctagccgctattataaaaaaacaaatgatggtaaatggctccttcgcagagca
atggaacgatatgtcccaactcacattattgaggctgttaaacaaggattttcagcacca
gatgcttcttggttcaggggcgaaagtatagactttgtccatcgatatttattttcacaa
aatgtacgcctttatgagtactttgatcgtaaagtagtccatgagcttgtaactgaacat
ctggaaggaaatgccaataggcgtctttttatatggtcacttttaagctttgaagaatgg
cttcatcaatatttaccataa

DBGET integrated database retrieval system