KEGG   Lawsonia intracellularis PHE/MN1-00: LIC004Help
Entry
LIC004            CDS       T00354                                 

Gene name
rfbC
Definition
(GenBank) dTDP-6-deoxy-D-glucose-3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00521  Streptomycin biosynthesis
lip00523  Polyketide sugar unit biosynthesis
lip01130  Biosynthesis of antibiotics
Module
lip_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LIC004 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LIC004 (rfbC)
Enzymes [BR:lip01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LIC004 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CAJ53956
UniProt: Q1MNX7
Position
p3:5115..5657
Genome map
AA seq 180 aa AA seqDB search
MEVEKTSLEGVLLIKPKVWEDSRGYFLETWNKQRYIEIGLQLPFVQDNHSSSTLHTLRGL
HFQQQYPQGKLVSVSLGEVFDVAVDLRINSPTFGSWFGVILSEKNHYQMWIPPGLAHGFC
VLSERAHFHYKCTEYYYPQDESCICWNDPDIGIDWPVQHPNLSHKDKIAQSWADYVASIT
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggaaaagacgtctttagaaggcgtattactgattaaaccaaaagtatgggaa
gacagccgaggatactttctagagacatggaataaacaacgctatattgaaattggacta
caactaccctttgttcaggacaatcattcttcttcaacgcttcatacacttagaggtctt
cactttcaacaacagtatcctcaagggaaacttgtaagtgtctcattaggagaagttttt
gacgttgctgtagatcttcgtataaattctcctacctttggatcatggtttggtgtgatt
ctttcagagaagaatcattatcaaatgtggattccaccaggcttagctcatggtttctgt
gttctttcagaacgtgcccattttcactataaatgtacggaatactattatccacaagat
gaaagctgtatttgctggaatgatccagacattggtattgattggcctgtacagcatcca
aatctttcacacaaagataaaatagctcaatcttgggcagattatgttgcttctataaca
tag

DBGET integrated database retrieval system