KEGG   Lawsonia intracellularis PHE/MN1-00: LIC102Help
Entry
LIC102            CDS       T00354                                 

Gene name
yhjA
Definition
putative cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Brite
Enzymes [BR:lip01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LIC102 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p3:188379..189776
Genome map
AA seq 465 aa AA seqDB search
MRSVNLLAFLCVSITFFGLLNSSFSYGSQEQLAQKELKQLQDKVVSILEEKCLSCHSYNA
ELPFYTKIPGIKQIIEKDFKDGLRASDLNQDFIEASKKGIIDEATVAKLEWVIENHTMPP
AKFTAVHWGSRVSKEDEKIILEWVRKYRNTYYATGLASPERSNEPIQPIPDTIPYNKQKA
ALGEKLFNDRRLSHDNTIRCASCHVTSEGMADGKQFATGINKQKGHVNAPTVYNAIFNTR
QFWDGRAANLQEQASQPPLNPIEMGSTSWDEILGKLANDKKLTEEFLAVYPDGWTEKNVT
DAIAEYERLFITPNSPFDRWLKGDDTALTSDELRGYKLFKAYRCATCHVGKSMGGQSFEY
MDLKKDYFADRGYVEGVDDNGRMAFTHDPRDLHRFKVPNLRNIEMTAPYLHDGTVTSLDE
AVRIMGIYLVGMDIPKSDRDSIVLFLRTLTGQFNGQKVLGTPVPQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtgttaacttgttagctttcctctgtgtatctattactttttttggattactt
aatagttctttttcttatggctctcaagaacaactagcacaaaaggagcttaaacaacta
caggacaaggttgttagtattcttgaagaaaaatgtttatcttgtcattcatataatgca
gagttaccgttttatactaaaatcccaggcattaaacagattattgaaaaagactttaaa
gatggtctgcgagcatcagatttaaatcaagattttattgaagcttctaaaaaaggtata
atagatgaagcaactgtagctaaattagagtgggttatagaaaaccatacaatgcctcca
gcaaaatttacagctgtccactggggaagtagagtttcaaaggaagatgaaaaaattatt
cttgaatgggtaagaaaatatcgtaacacatattatgcaacagggttagcgtctccagaa
cgctctaatgaacctattcagccaattccagatactattccttataataaacaaaaagca
gcattaggagaaaaactttttaatgatagacgattatcccatgataatacaataagatgt
gctagttgccatgtaacaagtgagggaatggcggatggcaagcagtttgcgacagggatc
aataagcaaaaaggacatgttaatgctccaactgtatataatgctatttttaacactcgt
cagttttgggatggacgtgcagcaaatctccaagaacaagcttctcagcctccattaaac
cctatagaaatgggaagcactagttgggatgagattcttgggaagttagctaatgataag
aaattaacagaagagtttttggcagtttatcctgatgggtggactgaaaaaaatgttaca
gacgctattgctgagtatgagagactatttattacacccaatagcccatttgatcgttgg
cttaaaggtgatgatacagcactaacctcagatgaattgagaggatataaactctttaaa
gcatacaggtgtgcaacatgtcatgttggtaagtcaatgggtggacagtcctttgaatac
atggatcttaagaaagactattttgcagaccgtggatatgttgaaggagttgatgataat
ggtagaatggcctttacacatgatcctagggacttgcatcgatttaaggttccaaacctt
aggaatattgagatgacggctccatatcttcatgatggtactgttacaagtttagatgag
gctgttcgcattatgggtatctatcttgtaggaatggatattcctaagtcagatagagat
tctattgtgttatttttgagaacacttacaggtcagttcaatggtcaaaaagtccttgga
acgcctgtaccacaataa

DBGET integrated database retrieval system