KEGG   Lawsonia intracellularis N343: LAW_00429Help
Entry
LAW_00429         CDS       T02437                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lir  Lawsonia intracellularis N343
Pathway
lir00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lir01100  Metabolic pathways
lir01110  Biosynthesis of secondary metabolites
lir01130  Biosynthesis of antibiotics
lir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lir00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LAW_00429 (trpC)
Enzymes [BR:lir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LAW_00429 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG
Motif
Other DBs
NCBI-ProteinID: AGC49830
Position
complement(506988..507710)
Genome map
AA seq 240 aa AA seqDB search
MPDSLVEMPNTLDFCKIFTTSSKPIIISEVKFSSPSCGQIYQGKLNHVDIAGDYLNSGAA
ALSVLAEPDYFQGSISFIKDIRGAHLNSYILLKDFVLSKKQIAQGLLYGANAVLLIVAFL
NKDLLKELYDYSLDLGLTPIIEVHDGFELEQALQLSPQIIGINNRNLQTLEISLDTAWNL
IKYIPNDCYAICESGIDNATQIREMMDIGFDGFLIGSSLMKYENPGVELQKLISEVCNKS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatagcctcgtagaaatgccaaatacactagatttctgcaagatattcaccacc
tcttcaaaacctatcattattagtgaggtaaaattttcaagtccttcttgtgggcagata
tatcaaggtaaactaaaccatgtcgatattgccggagattatcttaattcaggtgctgct
gctctttcagtattagctgaacctgactatttccaaggcagcatatctttcattaaagat
atcagaggtgctcatcttaattcttatatattactcaaagactttgttttaagcaaaaaa
cagattgcacaagggcttttatatggtgctaatgccgtattgcttattgtggccttcttg
aataaagatttattaaaagagctttatgattattctttagatttaggccttacaccgatt
atagaagtgcatgatggttttgagttagaacaagctttgcagctttctcctcaaattatt
gggattaataatcggaatttacaaacattagaaatcagtttggataccgcttggaacttg
ataaagtatataccaaatgattgttatgctatatgtgaaagtgggatagataatgccact
caaattcgagagatgatggatattggatttgatggatttctaattggttcgtccttgatg
aaatatgagaatcctggagtcgaactacaaaaattgatatctgaggtgtgtaataaaagc
taa

DBGET integrated database retrieval system