KEGG   Lawsonia intracellularis N343: LAW_00761Help
Entry
LAW_00761         CDS       T02437                                 

Gene name
ychB
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lir  Lawsonia intracellularis N343
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lir00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919163..920080
Genome map
AA seq 305 aa AA seqDB search
MIYSHLSSTSCTITTGCKVNLNLYITGILPNGWHKIDSIFLPLSEPHDELHIEITNHNQG
LHLSCNILDIELENNILTKTYTLFTKATHFTPSISIYLKKGIPYGAGLGGGSSDAAALLT
WLQKNSPLPLSPSKLLKLAAEIGADVPFFLKNKPCRATGIGEKLEEISLSNLNISGNTLF
IICPNLKISTPYAYKMWDDYNKKQIATSSRYNNNLTKKYSWDRSSPSTHLSDYLWMKNDF
EPVIFSEYTELSVFKEQLLQFGARAAVLSGSGSSIYGLFKEYNQTSIMTEFYKKKNILTF
SQLLQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatttattctcacctttctagtaccagttgtacgattactactggatgtaaagtaaat
cttaatctatatattacaggaattcttcctaatggttggcataaaatagactctattttt
ctaccactatctgaacctcatgatgaacttcatattgaaataactaatcataaccaaggg
cttcatctttcctgcaatattcttgatattgagttagagaataatattctgacaaaaact
tataccctttttactaaggctacacattttaccccttctatttctatatatttaaaaaaa
gggatcccttatggagctggtcttggtggtggtagctcagatgctgctgcattactaact
tggttacaaaaaaatagtccacttcccttatctccatcaaaactactaaaacttgctgct
gagattggtgcagatgtcccattttttcttaaaaataaaccttgtcgagctactggcatt
ggagagaagttagaagaaatctctctttctaaccttaatatttcaggcaatacgcttttt
attatttgtccaaacctaaaaatttcaaccccatatgcatataaaatgtgggatgattat
aataaaaaacagatagctacctcctcacgttataacaataacttgacaaaaaaatactct
tgggatagaagctcaccatccacccatctgtcagactacttgtggatgaaaaatgatttt
gagccagttatcttttctgaatacacagaattaagtgtattcaaagaacaactccttcag
tttggagcgcgagctgctgtactaagtggtagtggatcatcaatatatggcttatttaaa
gaatataaccagacgtcaattatgactgagttttataagaaaaaaaatattttaacattc
agtcagttattgcagtag

DBGET integrated database retrieval system