KEGG   Lawsonia intracellularis N343: LAW_20008Help
Entry
LAW_20008         CDS       T02437                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lir  Lawsonia intracellularis N343
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lir00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2:complement(12812..14692)
Genome map
AA seq 626 aa AA seqDB search
MCGVCGIICLDGDKPSKEVLSHMLDAIRHRGPDKANVVVDGCIALGHCRLAILDLTDAAA
QPMSTSDKLFTIVYNGEIYNFEEIRRELIKLGHTFISRSDTEVILHAYIQWGAQCVTKFN
GMFVFVIYDVIRKQIFIARDRYGIKPLYYTIIQNNFLFSSEAKAFLRYPQFCTKLDYEAL
LEYFTFQNILTDKTLLHNVYIFPPGHYAILPLNTGQLTFSQYWDYCFDESKNIHSDKEYE
EELTYLIQQAVQRQLQSDVELGTYLSGGMDSGSITALASKRFPYIKSFTCGFDLHSISGL
ELAFDERNAAEAMSYLFKTEHYEMVLKSGDMERVFPRLAWHIEEPRTGQSYPNFCIAHLV
SKFVKVVLAGTGSDELFGGYPWRYYRALGEKGENSFEKYIDRYYLFWQRLIPNRYLLSMF
KPIETHVRHVRTRDIFRNIFGDNNSPVTSHEESINRSLYFEAKTFLHGLLVVEDKLSMAH
SLETRLPFLDNDLVDFAMRLPVRCKIHRLNETLRINENESAKASRYYKKTNDGKWLLRRA
MERYVPTHIIEAVKQGFSAPDASWFRGESIDFVHRYLFSQNVRLYEYFDRKVVHELVTEH
LEGNANRRLFIWSLLSFEEWLHQYLP
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggagtttgtggcataatttgtttagatggagacaaaccttcaaaagaagtatta
agtcatatgctcgatgctattagacatcgtggcccagacaaggcaaatgttgtagttgat
ggatgtatagcacttgggcactgtcggctcgcaattcttgatctaacggacgctgcagca
caaccaatgtctacttcagataaactttttactatagtatataatggtgaaatttataac
tttgaagaaatccgacgagagctaataaaattaggacatacatttattagccgtagtgac
acagaagtcattcttcatgcttatattcagtggggagcgcaatgtgtaacaaaatttaat
ggaatgtttgtctttgttatatacgatgttattcgaaaacaaatatttatagctcgtgat
cgttatggtataaaaccattatactatactatcatccaaaataactttttatttagttca
gaggcaaaagccttcttacgttatccacaattctgtacgaaattagattatgaagcccta
ctagaatattttacttttcaaaatattctaacagataaaacattactgcataatgtctat
atattccctcctgggcactatgctattttacctttaaatacaggccaacttactttttca
caatattgggattattgctttgatgaaagtaagaatatccattctgataaagagtatgaa
gaagaattaacatatcttattcagcaggctgtacagcgtcagctgcaaagtgatgttgag
ctaggtacttatttatctggaggaatggattcaggttcaattacagctttagcttctaaa
cgtttcccatatattaaatcatttacttgtggctttgatctccattccatttcagggtta
gaacttgcttttgatgaacgtaatgcagcagaagcaatgtcttatctattcaaaacagaa
cactatgaaatggtcctaaaatctggagatatggaacgagtatttcctcgtttagcttgg
catatagaagaaccacggacaggacaaagttatcccaatttttgtatagcacacctggtc
tcaaaatttgttaaagttgttctagctggtactggtagtgatgaactttttggtggatat
ccttggcgttattatagagctcttggagaaaaaggagaaaatagttttgaaaagtatatt
gatcgttattatttattctggcaacgacttatacctaatcgatatctactaagcatgttc
aaacctattgaaactcatgttcgtcatgtacggacacgtgatatttttcgtaatatattt
ggtgataataattctcctgtaaccagtcatgaagaaagtattaatcgttccctctatttt
gaagctaaaactttcttacatggattactagttgtagaagataaactttctatggcacac
agtttggaaacacgccttccatttcttgataatgaccttgttgattttgctatgcgttta
cctgtaaggtgtaaaattcatagactcaatgaaacattaagaatcaacgaaaatgaatca
gctaaagctagccgctattataaaaaaacaaatgatggtaaatggctccttcgcagagca
atggaacgatatgtcccaactcacattattgaggctgttaaacaaggattttcagcacca
gatgcttcttggttcaggggcgaaagtatagactttgtccatcgatatttattttcacaa
aatgtacgcctttatgagtactttgatcgtaaagtagtccatgagcttgtaactgaacat
ctggaaggaaatgccaataggcgtctttttatatggtcacttttaagctttgaagaatgg
cttcatcaatatttaccataa

DBGET integrated database retrieval system