KEGG   Lawsonia intracellularis N343: LAW_30005Help
Entry
LAW_30005         CDS       T02437                                 

Definition
dTDP-6-dehydrorhamnose 3,5-epimerase (EC:5.1.3.15)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lir  Lawsonia intracellularis N343
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:lir00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lir00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p3:5146..5688
Genome map
AA seq 180 aa AA seqDB search
MEVEKTSLEGVLLIKPKVWEDSRGYFLETWNKQRYIEIGLQLPFVQDNHSSSTLHTLRGL
HFQQQYPQGKLVSVSLGEVFDVAVDLRINSPTFGSWFGVILSEKNHYQMWIPPGLAHGFC
VLSERAHFHYKCTEYYYPQDESCICWNDPDIGIDWPVQHPNLSHKDKIAQSWADYVASIT
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggaaaagacgtctttagaaggcgtattactgattaaaccaaaagtatgggaa
gacagccgaggatactttctagagacatggaataaacaacgctatattgaaattggacta
caactaccctttgttcaggacaatcattcttcttcaacgcttcatacacttagaggtctt
cactttcaacaacagtatcctcaagggaaacttgtaagtgtctcattaggagaagttttt
gacgttgctgtagatcttcgtataaattctcctacctttggatcatggtttggtgtgatt
ctttcagagaagaatcattatcaaatgtggattccaccaggcttagctcatggtttctgt
gttctttcagaacgtgcccattttcactataaatgtacggaatactattatccacaagat
gaaagctgtatttgctggaatgatccagacattggtattgattggcctgtacagcatcca
aatctttcacacaaagataaaatagctcaatcttgggcagattatgttgcttctataaca
tag

DBGET integrated database retrieval system