KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0080Help
Entry
LIV_0080          CDS       T01623                                 

Definition
(GenBank) Putative L-Fuculose-1-Phosphate Aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00051  Fructose and mannose metabolism
liv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LIV_0080
Enzymes [BR:liv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LIV_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CBW84563
UniProt: G2Z8V8
Position
90740..91432
Genome map
AA seq 230 aa AA seqDB search
MEIEVLKDLICDVCHKMWQQDWVAANDGNVTARLEENMYIATPTGISKSFITPDKLLLIN
GKGELLEENPEGYRPSSEIKMHLRCYEEREDVGAVVHAHPPTATGFALAQIPLDSYSLIE
SSITIGSVPITPFGTPSTMEVPEAITPYLPEHDVLLLENHGALSVGSDLITAYYRMETLE
LVAKTMFVARMLRGGEVEKEIPRENLERLFKMRGNYKITGKHPGYKKYSK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagatagaagtactaaaagatttaatatgtgatgtctgtcataaaatgtggcaacag
gattgggttgcggcaaatgatggaaatgttactgctaggttagaagagaatatgtatatt
gcaacgccaacaggaattagcaagagttttataactcctgataaattattattaattaat
gggaaaggggaattgctcgaagaaaatcctgaggggtatcgcccgtcaagcgagattaaa
atgcatttgcgttgttacgaggaacgagaggatgttggcgcggttgttcatgcccatccc
ccgactgctacaggatttgctttagcacaaataccacttgactcgtactcccttattgag
agttctatcactatcggttctgtgccaattacaccattcgggacaccatcaactatggaa
gttcctgaggcgattaccccatacttaccagaacacgatgtactccttcttgaaaatcat
ggagcgttatcggttggtagtgatttaattacagcgtactaccggatggaaaccttggaa
ttagttgcaaagacaatgtttgttgctcgtatgctgcgaggcggggaagtggagaaagaa
attccgcgtgaaaatctggagcgcttatttaaaatgcgtggaaattataaaatcacaggg
aaacaccccggctataagaagtactcgaaatga

DBGET integrated database retrieval system