KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0080Help
Entry
LIV_0080          CDS       T01623                                 

Definition
putative L-Fuculose-1-phosphate Aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LIV_0080
Enzymes [BR:liv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LIV_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90740..91432
Genome map
AA seq 230 aa AA seqDB search
MEIEVLKDLICDVCHKMWQQDWVAANDGNVTARLEENMYIATPTGISKSFITPDKLLLIN
GKGELLEENPEGYRPSSEIKMHLRCYEEREDVGAVVHAHPPTATGFALAQIPLDSYSLIE
SSITIGSVPITPFGTPSTMEVPEAITPYLPEHDVLLLENHGALSVGSDLITAYYRMETLE
LVAKTMFVARMLRGGEVEKEIPRENLERLFKMRGNYKITGKHPGYKKYSK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagatagaagtactaaaagatttaatatgtgatgtctgtcataaaatgtggcaacag
gattgggttgcggcaaatgatggaaatgttactgctaggttagaagagaatatgtatatt
gcaacgccaacaggaattagcaagagttttataactcctgataaattattattaattaat
gggaaaggggaattgctcgaagaaaatcctgaggggtatcgcccgtcaagcgagattaaa
atgcatttgcgttgttacgaggaacgagaggatgttggcgcggttgttcatgcccatccc
ccgactgctacaggatttgctttagcacaaataccacttgactcgtactcccttattgag
agttctatcactatcggttctgtgccaattacaccattcgggacaccatcaactatggaa
gttcctgaggcgattaccccatacttaccagaacacgatgtactccttcttgaaaatcat
ggagcgttatcggttggtagtgatttaattacagcgtactaccggatggaaaccttggaa
ttagttgcaaagacaatgtttgttgctcgtatgctgcgaggcggggaagtggagaaagaa
attccgcgtgaaaatctggagcgcttatttaaaatgcgtggaaattataaaatcacaggg
aaacaccccggctataagaagtactcgaaatga

DBGET integrated database retrieval system