KEGG   Listeria ivanovii: LIV_0083Help
Entry
LIV_0083          CDS       T01623                                 

Definition
putative L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
liv  Listeria ivanovii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:liv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
93328..95094
Genome map
AA seq 588 aa AA seqDB search
MTNYPAIGIRPTIDGRRRGVRESLEEQTMTMAQSVAVLLEKTLKYPNGKPVRCVIADQTI
GGIHEATLAKAKFHKEEVGLTITVTPCWCYGTETMDIDSQIPHAVWGFNGTERPGAVYLA
AVLSAFAQKGIPAFGIYGRDIQDAGDTTIPDDVAEKLIQFSRAGLAVSLMKNQAYLSIGN
VSMGIAGSIVKDDFFQEYLGMRNEYVDMTEFVRRINEEIYDKAEFEKAKSWVKENLEQGA
DNNPVHLQSKPEKAREEWDTSIKMALIGRDLMVGNKKLAEAGFEEEAAGHHAILSGFQGQ
RQWTDYFPNGDFMETILNSSFDWNGPRAPYLMATENDSCNGVSMLFNYLLTNTAQIFADV
RTYWSPDSVKRVTNYDLEDHAKNGILHLINSGSAALDGAGREVNEGVPVIKPFWEITGQE
VKNTLAHTKFRPASKEYFRGGGFSTNYLTTGGMPLTMARLNIVKGLGPVLQIVEGYSVKL
PEKVHQVLDERTDPTWPTTWFAPILTGEGAFSDVYQVMNNWGANHGAISYGHIGADLITL
ASMLRIPVNMHNIEGEKIFRPRVWSMFGTAGLEGADFRACQNFGPIYK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactatccagcaatcggtattcggccgacaattgatggccgcagacgaggagtg
agagaatcacttgaagaacaaacgatgacaatggcgcaaagtgtagctgtattattagaa
aaaacgttaaaatatcctaatggaaaaccagttcggtgtgtgattgctgatcaaacaatt
ggaggaattcatgaagctactctagcaaaagccaaatttcacaaggaagaggttggttta
acgattaccgttaccccgtgttggtgttacggtactgaaacaatggatattgatagtcaa
attcctcatgccgtttgggggtttaatggtacagaacgaccaggagcagtctatttagca
gctgtattatcggcatttgctcaaaaaggaattccagcatttggtatttacgggcgagac
atacaagatgcaggggatacgaccattccagatgatgttgccgagaaattgattcaattt
tcccgcgcaggattagctgtatctttaatgaaaaaccaagcttacttatctattggaaat
gtttctatgggaattgccggatcaattgttaaagatgatttttttcaagaatatttaggg
atgcgtaatgaatatgttgacatgacagaatttgttcgtcggattaacgaagaaatatat
gacaaagcagaatttgaaaaggcaaagagctgggtgaaagaaaatctggaacaaggtgca
gacaacaatccagtgcatttacaaagtaagccggaaaaagcccgagaagagtgggataca
agcattaaaatggcgctgattggtcgagatttaatggtaggaaataaaaaattagcagag
gctggctttgaagaagaagcggcaggtcatcatgctattttgtcaggttttcaaggacaa
cgacaatggactgattattttcccaatggtgattttatggaaacaattttaaatagttcg
tttgattggaatggtccacgtgcaccatatttaatggctactgaaaatgatagttgtaat
ggcgtatcaatgttatttaattatttattaactaatacagcgcaaatttttgccgatgta
cgaacatactggagtccggattcggtaaaacgtgtcactaattatgatttagaggatcat
gctaaaaatggaattcttcatttaattaattctggctctgctgcgcttgatggagctgga
agagaagttaacgagggtgttcctgttatcaagcctttttgggaaattactgggcaagaa
gtgaaaaatacgttggcacatacaaaatttcgaccagcttctaaagaatattttcgtggt
ggcgggttttccacgaattatttaacgacaggtggaatgccgctaactatggctcgctta
aatatagtgaaaggactaggaccagtactccaaattgtagaaggttattcagttaagctc
ccagaaaaagtgcatcaagtgctggatgaacgaacggatcccacttggccaacgacatgg
tttgcaccaattttaactggggaaggagcattttcagatgtgtaccaggtgatgaataac
tggggtgcaaatcatggggcaatatcatatggacatattggtgccgatttgattacactt
gcttcgatgctaagaatcccagtgaatatgcataatatcgagggggaaaagattttccgt
ccccgtgtttggtcaatgttcgggacggccggcttagaaggtgctgattttagagcatgc
caaaacttcggacctatctataaatag

DBGET integrated database retrieval system