KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0083Help
Entry
LIV_0083          CDS       T01623                                 

Definition
putative L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LIV_0083
Enzymes [BR:liv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     LIV_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
93328..95094
Genome map
AA seq 588 aa AA seqDB search
MTNYPAIGIRPTIDGRRRGVRESLEEQTMTMAQSVAVLLEKTLKYPNGKPVRCVIADQTI
GGIHEATLAKAKFHKEEVGLTITVTPCWCYGTETMDIDSQIPHAVWGFNGTERPGAVYLA
AVLSAFAQKGIPAFGIYGRDIQDAGDTTIPDDVAEKLIQFSRAGLAVSLMKNQAYLSIGN
VSMGIAGSIVKDDFFQEYLGMRNEYVDMTEFVRRINEEIYDKAEFEKAKSWVKENLEQGA
DNNPVHLQSKPEKAREEWDTSIKMALIGRDLMVGNKKLAEAGFEEEAAGHHAILSGFQGQ
RQWTDYFPNGDFMETILNSSFDWNGPRAPYLMATENDSCNGVSMLFNYLLTNTAQIFADV
RTYWSPDSVKRVTNYDLEDHAKNGILHLINSGSAALDGAGREVNEGVPVIKPFWEITGQE
VKNTLAHTKFRPASKEYFRGGGFSTNYLTTGGMPLTMARLNIVKGLGPVLQIVEGYSVKL
PEKVHQVLDERTDPTWPTTWFAPILTGEGAFSDVYQVMNNWGANHGAISYGHIGADLITL
ASMLRIPVNMHNIEGEKIFRPRVWSMFGTAGLEGADFRACQNFGPIYK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactatccagcaatcggtattcggccgacaattgatggccgcagacgaggagtg
agagaatcacttgaagaacaaacgatgacaatggcgcaaagtgtagctgtattattagaa
aaaacgttaaaatatcctaatggaaaaccagttcggtgtgtgattgctgatcaaacaatt
ggaggaattcatgaagctactctagcaaaagccaaatttcacaaggaagaggttggttta
acgattaccgttaccccgtgttggtgttacggtactgaaacaatggatattgatagtcaa
attcctcatgccgtttgggggtttaatggtacagaacgaccaggagcagtctatttagca
gctgtattatcggcatttgctcaaaaaggaattccagcatttggtatttacgggcgagac
atacaagatgcaggggatacgaccattccagatgatgttgccgagaaattgattcaattt
tcccgcgcaggattagctgtatctttaatgaaaaaccaagcttacttatctattggaaat
gtttctatgggaattgccggatcaattgttaaagatgatttttttcaagaatatttaggg
atgcgtaatgaatatgttgacatgacagaatttgttcgtcggattaacgaagaaatatat
gacaaagcagaatttgaaaaggcaaagagctgggtgaaagaaaatctggaacaaggtgca
gacaacaatccagtgcatttacaaagtaagccggaaaaagcccgagaagagtgggataca
agcattaaaatggcgctgattggtcgagatttaatggtaggaaataaaaaattagcagag
gctggctttgaagaagaagcggcaggtcatcatgctattttgtcaggttttcaaggacaa
cgacaatggactgattattttcccaatggtgattttatggaaacaattttaaatagttcg
tttgattggaatggtccacgtgcaccatatttaatggctactgaaaatgatagttgtaat
ggcgtatcaatgttatttaattatttattaactaatacagcgcaaatttttgccgatgta
cgaacatactggagtccggattcggtaaaacgtgtcactaattatgatttagaggatcat
gctaaaaatggaattcttcatttaattaattctggctctgctgcgcttgatggagctgga
agagaagttaacgagggtgttcctgttatcaagcctttttgggaaattactgggcaagaa
gtgaaaaatacgttggcacatacaaaatttcgaccagcttctaaagaatattttcgtggt
ggcgggttttccacgaattatttaacgacaggtggaatgccgctaactatggctcgctta
aatatagtgaaaggactaggaccagtactccaaattgtagaaggttattcagttaagctc
ccagaaaaagtgcatcaagtgctggatgaacgaacggatcccacttggccaacgacatgg
tttgcaccaattttaactggggaaggagcattttcagatgtgtaccaggtgatgaataac
tggggtgcaaatcatggggcaatatcatatggacatattggtgccgatttgattacactt
gcttcgatgctaagaatcccagtgaatatgcataatatcgagggggaaaagattttccgt
ccccgtgtttggtcaatgttcgggacggccggcttagaaggtgctgattttagagcatgc
caaaacttcggacctatctataaatag

DBGET integrated database retrieval system