KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0160Help
Entry
LIV_0160          CDS       T01623                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LIV_0160
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LIV_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
176026..176922
Genome map
AA seq 298 aa AA seqDB search
MKISVTAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDVIVLNVKAHFI
PEDRRNLIYQAAALLKKRFDVKAGVRITIDKHIPVSAGLAGGSSDAAAALKGLNIIWELG
LSIEELAEISSEIGSDIAFCVYGGTAIATGRGEKISSLPNMPGCWIVLAKPSISISTPTI
YKELQVDNVAHPNTKKMIEAIEQGDLDGIFAATGNVLESVTLEKNPQVKRIKDRMLAFGA
ETALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSESENDTIKGSEGSDK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagtgtaacggcgccagctaaaattaatctttcccttgatgctctttacaaa
cgtgaagacggttatcatgaagtagagatggtaatgaccacgattgatcttgcggataga
ctttatttagagcggctagatgaggacgttattgtattaaacgtaaaggcgcactttatc
ccggaagaccgccgcaatttaatttatcaagcagcggcacttttgaaaaaacgttttgat
gtaaaagcaggagtgcgaattacgatagataaacatattccggtttctgcgggacttgca
ggtggaagctcggatgcagcggcagcacttaaaggactaaacattatttgggagctagga
ctttcgatagaggagctagcagaaatcagctcagaaattggttctgatattgccttttgt
gtttatggtgggactgccattgcaactggtcgtggggagaagatttcttcacttcctaat
atgccaggttgctggattgtacttgctaaacctagcattagtatatcgacaccaaccatt
tataaagagttacaggtagataatgtagcacatcctaatacgaaaaaaatgatagaggca
attgaacaaggcgacttagacggaatttttgctgctacaggaaatgttctggaatctgta
acgttagagaaaaatccacaagttaaacggattaaagaccggatgctcgcgtttggtgct
gagacggctttaatgagtggtagtggtccgacagtatttgcgctcatcaaacagtactca
agagcgaaacgtgtctataacggcttgcgtggcttttgtgaggaagtatatatggttagg
ccatggagtgaaagtgaaaatgatactattaaaggttcggaggggtcagacaaatga

DBGET integrated database retrieval system