KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0194Help
Entry
LIV_0194          CDS       T01623                                 

Gene name
sul
Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LIV_0194 (sul)
Enzymes [BR:liv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LIV_0194 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216751..217566
Genome map
AA seq 271 aa AA seqDB search
MKKWKKDHLGMVMGILNVTPDSFSDGGKYMNVEKAVARAVQMAEDGAAIIDVGGISTRPG
FSEVSQNEELTRIIPVIKAIREKLPDIWISVDTWRAAVAEQAVLAGADMINDQWGAKKEP
EIAQIAAQYNVPICLMHNRENAQYENFLEDVKTDLLESVAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLILGGSPDDRMEGTGATAVYGFAKG
CTITRVHDVLPIARMIRMTDAITGKLDITKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaatggaaaaaggaccatttaggtatggtcatgggaattttaaatgttacacca
gactctttttcggatggtggtaagtatatgaatgtagaaaaagctgttgctcgtgctgtg
caaatggctgaggatggtgcggcaatcattgatgttggcggaatatctacgcgacctggt
ttttcagaagtctctcaaaatgaagaattaacgagaattatcccggttattaaagcgata
agagaaaaattgccagatatatggatatcagtggacacatggcgagcggcagttgctgaa
caagctgttttggccggggctgatatgataaatgaccagtggggcgcgaaaaaagaaccg
gaaattgcacaaattgcagctcagtataatgttccaatctgtttaatgcacaaccgagaa
aatgctcaatatgaaaactttttagaagacgtgaaaacggatcttttggaaagtgtggca
attgcaaaggctgcttctgtaccagatgaacatattatattggatccgggatttggattt
gttaagacgccagcacaaaatttagaagttttgcgacggatagacgaaattgttgcgctt
gggtatgaagttttactaggaacaagtcgaaaatcaaccattggcctaattttaggagga
tcacctgacgatagaatggaaggtactggagctaccgcggtttacggttttgcaaaaggg
tgtacaattacacgagtgcatgatgtcttgccgattgctcgaatgattcggatgacagat
gcgattactgggaagttagatataacgaaattataa

DBGET integrated database retrieval system