KEGG   Listeria ivanovii: LIV_0194Help
Entry
LIV_0194          CDS       T01623                                 

Gene name
sul
Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
liv  Listeria ivanovii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:liv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216751..217566
Genome map
AA seq 271 aa AA seqDB search
MKKWKKDHLGMVMGILNVTPDSFSDGGKYMNVEKAVARAVQMAEDGAAIIDVGGISTRPG
FSEVSQNEELTRIIPVIKAIREKLPDIWISVDTWRAAVAEQAVLAGADMINDQWGAKKEP
EIAQIAAQYNVPICLMHNRENAQYENFLEDVKTDLLESVAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLILGGSPDDRMEGTGATAVYGFAKG
CTITRVHDVLPIARMIRMTDAITGKLDITKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaatggaaaaaggaccatttaggtatggtcatgggaattttaaatgttacacca
gactctttttcggatggtggtaagtatatgaatgtagaaaaagctgttgctcgtgctgtg
caaatggctgaggatggtgcggcaatcattgatgttggcggaatatctacgcgacctggt
ttttcagaagtctctcaaaatgaagaattaacgagaattatcccggttattaaagcgata
agagaaaaattgccagatatatggatatcagtggacacatggcgagcggcagttgctgaa
caagctgttttggccggggctgatatgataaatgaccagtggggcgcgaaaaaagaaccg
gaaattgcacaaattgcagctcagtataatgttccaatctgtttaatgcacaaccgagaa
aatgctcaatatgaaaactttttagaagacgtgaaaacggatcttttggaaagtgtggca
attgcaaaggctgcttctgtaccagatgaacatattatattggatccgggatttggattt
gttaagacgccagcacaaaatttagaagttttgcgacggatagacgaaattgttgcgctt
gggtatgaagttttactaggaacaagtcgaaaatcaaccattggcctaattttaggagga
tcacctgacgatagaatggaaggtactggagctaccgcggtttacggttttgcaaaaggg
tgtacaattacacgagtgcatgatgtcttgccgattgctcgaatgattcggatgacagat
gcgattactgggaagttagatataacgaaattataa

DBGET integrated database retrieval system