KEGG   Listeria ivanovii: LIV_0196Help
Entry
LIV_0196          CDS       T01623                                 

Gene name
folK
Definition
putative 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
liv  Listeria ivanovii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:liv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
217949..218428
Genome map
AA seq 159 aa AA seqDB search
MAKAFLSIGTNIGERLVNLNNAVSGLAAAEQIEMVKVSSIYETDAVGFEDQAAFFNIVIE
IETSFPPEDLLDFCLKLELELGRVRLFKWGPRLIDIDVLLYDDVKMDTEKLKIPHPYMKE
RAFVMIPLVEISPDKAGIQVDQAVLAEQGVRKIKKQVKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcttttttatctataggaacaaatattggtgagcgattggttaatttaaat
aatgcagttagtggcttagcggctgcagagcaaattgaaatggtgaaagtatccagcatc
tatgaaacggatgcagtaggttttgaagatcaagctgctttttttaatattgttatcgaa
attgaaacgagttttcccccagaggatctattagacttttgcttaaagctggagctcgaa
ttaggaagagtccgtttgttcaaatggggaccacgattaatcgatattgatgttttgtta
tatgatgatgttaaaatggatacagaaaagctgaaaatcccacatccttatatgaaagaa
agagcttttgtgatgataccgttagtggagatttctcctgataaggcaggaattcaggtt
gatcaggctgttttggctgagcaaggcgtccggaaaataaaaaaacaagtgaagtggtaa

DBGET integrated database retrieval system