KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0196Help
Entry
LIV_0196          CDS       T01623                                 

Gene name
folK
Definition
putative 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LIV_0196 (folK)
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LIV_0196 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
217949..218428
Genome map
AA seq 159 aa AA seqDB search
MAKAFLSIGTNIGERLVNLNNAVSGLAAAEQIEMVKVSSIYETDAVGFEDQAAFFNIVIE
IETSFPPEDLLDFCLKLELELGRVRLFKWGPRLIDIDVLLYDDVKMDTEKLKIPHPYMKE
RAFVMIPLVEISPDKAGIQVDQAVLAEQGVRKIKKQVKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcttttttatctataggaacaaatattggtgagcgattggttaatttaaat
aatgcagttagtggcttagcggctgcagagcaaattgaaatggtgaaagtatccagcatc
tatgaaacggatgcagtaggttttgaagatcaagctgctttttttaatattgttatcgaa
attgaaacgagttttcccccagaggatctattagacttttgcttaaagctggagctcgaa
ttaggaagagtccgtttgttcaaatggggaccacgattaatcgatattgatgttttgtta
tatgatgatgttaaaatggatacagaaaagctgaaaatcccacatccttatatgaaagaa
agagcttttgtgatgataccgttagtggagatttctcctgataaggcaggaattcaggtt
gatcaggctgttttggctgagcaaggcgtccggaaaataaaaaaacaagtgaagtggtaa

DBGET integrated database retrieval system