KEGG   Listeria ivanovii: LIV_0206Help
Entry
LIV_0206          CDS       T01623                                 

Gene name
gltX
Definition
putative glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
liv  Listeria ivanovii
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:liv00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240633..242108
Genome map
AA seq 491 aa AA seqDB search
MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNVEDGEES
QMKNLKWLGIDWDEGVDVPGKYGPYRQSERQSIYEPLIQKLLDEGLAYKCYCTEDELEAE
REKQKANGEMPRYSGKCRHLTKEQQVEKEEQGFNPSIRFKVPANQTITFNDMVKEDVSFE
SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQLLIYNAFGWEPPI
FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGEEEIFSKE
EFIQMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVVELSLPHLQKAGVVSEELDQA
ELNWVHKLVSLYHEQMSYGAEIVPLSEMFFADADSITFDEEEKAVLVEETVPTVISAFKK
ELEALEVLEATEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGKEKV
INRLDTWLQNN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaacaaaacgtgtacgtgtacgttatgcgccgagtccaactggatttttgcat
attgggaatgcgcgtacagccttatttaactatttatttgcaagacataatgatggagac
tttattatcagaattgaagacacggatgctaaacgtaacgtggaagacggagaagaaagc
caaatgaaaaacctgaaatggcttggtatagactgggatgaaggagttgatgtccctgga
aaatacggaccttaccgtcaatctgaacgtcaatccatctatgaaccacttattcaaaaa
cttttggatgaaggcttggcttataaatgttattgtacagaagatgaattagaagcagaa
cgcgaaaaacaaaaagcaaatggtgaaatgcctcgttatagcgggaaatgtcgccattta
acaaaagaacaacaagtagaaaaagaagagcaaggctttaatccaagtattcgttttaaa
gtacctgcaaaccaaacgattacttttaacgatatggtaaaagaggatgtttcttttgaa
tcgaatggtattggagactttgttattgcgaaaaaagatggtattccaacatataatttt
gcagtagcagtagatgatcatttaatggagatttctcatgtgcttcgcggagatgatcac
atttccaatacaccgaaacaattacttatttataatgcttttggttgggagccaccaatt
tttggtcatatgactcttattgtaaatgaaagcagacgtaaattaagtaagcgtgacggt
tcgattattcaatttattgagcaatatcgtgatttaggttatttgccagaagcgttattt
aattttattgcaatgcttggttggtccccagaaggcgaagaagaaattttctctaaagaa
gaattcatccaaatgtttgatccaaaacgtctatctaaatcaccagcgttgtttgataat
gttaaattaacgtgggtgaacaaccaatatgtgaagaaattaccgctaaatgatgtcgta
gagctttctttaccacatttacaaaaggccggagttgtttctgaagagttagaccaagct
gaacttaattgggtacacaagttagtttcgctttaccatgaacaaatgagttatggtgcg
gaaatcgtgccactttcggaaatgttctttgcggatgcggattcgattacttttgatgag
gaagaaaaagcggttcttgtagaagaaactgttccaactgttatctcagctttcaaaaag
gaattggaagctttagaagttctagaagctactgaagtaaaagcggctatcaaacgcgtt
caaaaagaaactggtgtcaaaggtaaagggctatttatgccaattcgaattgtgactact
ggtgaaatgcacggtcctgaattgccactcgctattgaagtgcttggcaaggaaaaagtg
attaatcgattagatacatggctacaaaataactaa

DBGET integrated database retrieval system