KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0236Help
Entry
LIV_0236          CDS       T01623                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LIV_0236
Enzymes [BR:liv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LIV_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267603..269045
Genome map
AA seq 480 aa AA seqDB search
MQIKNKAMLITYSDSLGENMEELSKVMETYFEDAVGGIHLLPFFPSTGDRGFAPSDYTTV
DSDLGSWEMIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLNSKYKDMFIRINDFFPP
GRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNAFGEEQIDLDVTAEVTKEFIRQTIK
NMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKAEAAKYDMELLPEIHEHYS
IQMKIANHDYYIYDFALPMVMLYSLYSGRVERLAKWLEMSPMKQFTTLDTHDGIGVVDAR
DLLTDEELDYTSAELYKIGANVKKIYSSEKYNNLDIYQINSTYYSALGDDDKSYLLARVI
QCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYYTIDEIKNEVKRPVVKALCNLL
RFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKITATLKANLSTKTFQISENERNILI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattaaaaataaagctatgttaattacttattctgatagtttaggggaaaatatg
gaagaattatccaaggtgatggaaacttattttgaagatgcggttggcgggattcactta
ttgccgttctttccatccactggagatcgagggtttgcgccaagtgattacacaacagta
gatagcgacctaggctcttgggaaatgatcgagaaattaggcgaaaagtattatttaatg
tttgattttatgattaatcacatttctcgcgaatcactcttctttcaagattttaaaaaa
gagcatttaaactcaaagtataaagatatgtttattcgtatcaatgatttctttcctccg
ggtagaccaaatgaaaaagacttagatttaatttataagagaaaagacaaggcacctttc
caagaagttgaatttgctgatggagaaacggaattagtttggaatgcttttggggaagaa
caaattgatttagatgtgacagccgaagttacaaaagaatttattcgtcaaacgataaaa
aatatggctgcacatggttgttctattttgcgccttgacgcctttgcttatgcaattaaa
aaattagatacaaatgatttttttgtagaaccagaaatttgggatttactggatgaagtg
aaagcagaagcggccaaatatgatatggaattattaccagaaattcatgaacattattcc
atccaaatgaaaatcgcgaaccatgattattatatctatgattttgcgttacccatggtg
atgctgtactcgttatatagtggccgagtggaacgtttagctaaatggttagaaatgagt
ccgatgaagcaatttactactttagatacgcatgatggcattggcgttgtggatgcacgc
gatttattaacagatgaggaactcgattatacctcagcggaattatacaaaataggagct
aatgttaaaaagatatattcctctgaaaaatataataacctggatatttatcaaattaat
agtacctattatagtgctttgggtgacgatgacaaaagttacttgttggcgagagtaatt
caatgttttgcgccggggattccgcaaatttattatgttggtttacttgctggcaaaaat
gatattgaccttttagaggaaacaaaagaagggcgtaatattaatcgtcattactacaca
atagatgaaattaaaaatgaagtaaaaagaccagttgttaaagcgttgtgcaatttactg
agatttagaaatacttctgaagcgtttgatttggaaggaagtatagaaattgagacacct
agctcaaatgaaatcgttattattcgcaaaaacaaaacaaataaaattacagcgacatta
aaagcaaatttaagtactaaaacattccaaatcagcgaaaatgaaagaaatattttaatt
taa

DBGET integrated database retrieval system