KEGG   Listeria ivanovii: LIV_0240Help
Entry
LIV_0240          CDS       T01623                                 

Definition
putative phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
liv  Listeria ivanovii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:liv00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277635..279095
Genome map
AA seq 486 aa AA seqDB search
MTEMKKQFPKGFLWGGATAANQVEGAYDVDGKGLSTADMVRFIPKEERTQDHALDVSREE
IEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSLNWARIFPNGDDKEPNE
KGLAFYDSVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADRRVIGFFTNYAETVFKRY
KNKVKYWLTFNEINVISLSAYTGGGVLLEGEKKTLEVSYQAAHHQFVASALATKLAHEII
PGAQVGCMLARMATYPATNNPDDILKAQFENQQNLFFTDVHARGEYPSFMNRFFQENDIN
IVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSTGNLMGGVKNEYLESSDWGWQI
DPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEADGKIHDDYRIDYLRKHIEQMKEAIA
DGVDLIGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDWGKGTLERSRKDSFFWYKKVIGT
NGEDLD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatgaaaaaacaatttccaaaaggatttttatggggtggggctactgccgcg
aatcaagttgaaggcgcttacgacgttgatggaaaaggactttccacagcggatatggtt
agatttattcctaaagaagaacgaacacaagaccacgcattagacgtttcaagagaagaa
atcgaagcaattatcgctggcaaagtggagggcagatttccaaaacgtgacggcgttgat
ttttatcatcattataaagaagatatcgcactatttgccgaaatgggctttaaaacattc
cgtctatcattaaactgggctcgtattttcccgaatggtgatgacaaagaaccaaacgaa
aaaggtctcgctttttatgatagtgtatttgatgaattattaaaatacgatatcgaacca
ttagtaactctttcccattacgaaacgccattaaatttaactttaaaatataacggttgg
gcagatcgtcgcgttattggctttttcactaactatgcagaaactgttttcaaacgatat
aaaaacaaagtgaaatattggcttacttttaacgaaattaatgttatttctcttagcgca
tacactggtggcggcgtacttttagaaggagaaaaaaaaacgttagaagtctcttaccaa
gcagcgcatcatcaatttgtagcgagcgcacttgctacaaaactagcacatgaaattatt
ccaggagcacaagttggttgtatgcttgctcgtatggcaacatatccagcaacaaacaac
ccagatgatattctaaaagcacaatttgaaaaccaacaaaacctatttttcacagatgtt
catgcccgcggggaatatcctagcttcatgaatcgcttcttccaagaaaatgacatcaac
atcgtaaaagaagttggcgacgacgaaatcttaaaagcgcacacagttgatttcatctca
ttcagctattatatgtcattatctgcaactgctagcccagaaggagaccgttctactgga
aacttaatgggtggcgtgaaaaacgaataccttgagtcatccgattggggctggcaaatt
gaccctaaaggcttgcgttggactctaaatgatctttatagccgttatgaattaccactt
ttcattgtggaaaacggtttaggagcatacgatacagtagaagcagatgggaaaattcat
gatgattaccgaattgactacttacgcaaacacatcgaacaaatgaaagaagcaattgca
gacggcgtcgacttaatcggctacactagctgggggccaatcgacttagtaagtgcctcc
accagcgaaatgtcaaaacgctacggcttcatctacgtagaccaagacgactggggcaaa
ggaactctagaacgctcgagaaaagattctttcttctggtataaaaaagtaattggaact
aatggggaagatttagattaa

DBGET integrated database retrieval system