KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0439Help
Entry
LIV_0439          CDS       T01623                                 

Definition
(GenBank) Putative sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00010  Glycolysis / Gluconeogenesis
liv00052  Galactose metabolism
liv00500  Starch and sucrose metabolism
liv00520  Amino sugar and nucleotide sugar metabolism
liv00521  Streptomycin biosynthesis
liv01100  Metabolic pathways
liv01110  Biosynthesis of secondary metabolites
liv01120  Microbial metabolism in diverse environments
liv01130  Biosynthesis of antibiotics
liv01200  Carbon metabolism
Module
liv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
liv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIV_0439
   00052 Galactose metabolism
    LIV_0439
   00500 Starch and sucrose metabolism
    LIV_0439
   00520 Amino sugar and nucleotide sugar metabolism
    LIV_0439
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LIV_0439
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LIV_0439
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LIV_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: CBW84916
UniProt: G2ZA04
Position
476433..477299
Genome map
AA seq 288 aa AA seqDB search
MYRIGIDIGATNMRVALFDSDNQLIAREQVKTEAKLGPVQALGKLVSMVRLVDPERLAIG
IGIGAPGPLDVTNGTVLDAPNLPGWHGFPIRDELERLVNVPVFLMNDAKAAALAEAKIGS
GVGYDSVQYITVSTGIGGGFICRGELFPGSHGHASELGNMIVDVSSPNSTLENTCSGSAL
LRQSKQLFGENQTAAELFVQYEANQEEARQVIEQWLHHFSAAVTSIIQVIDPEVFVLGGA
VILRHPWLVEKLHPMVTKRVYSTMREDVQLKVASLGDDAGLYGASMFV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaattggaatagatatcggtgcaacgaatatgagagtggcgttgtttgattct
gacaatcagttgatagcacgtgaacaagtaaaaacagaggcgaagttaggacctgtccaa
gcattaggaaagttagtaagtatggttagactagttgatccagaacgcttagcaatcggt
attggaattggtgcacctggaccgcttgatgtgactaatggaacagttttagatgctcca
aatttacctggatggcacggattccctattagagatgagctcgagcgtcttgtaaatgta
ccagtgtttttgatgaatgatgccaaagcagctgcacttgctgaagcgaaaattggctcc
ggggtaggctacgatagtgtgcaatatatcacggtaagtacgggtattggtggtggtttc
atctgtagaggggaactgtttcctggcagtcatgggcatgcgtcagaacttgggaatatg
attgttgatgtgagttcgccaaatagtacgctggaaaacacatgtagtggtagcgccttg
ttaagacaaagtaaacaattgtttggagaaaaccagactgctgccgaattatttgtgcaa
tatgaagctaatcaggaagaagcgcgccaagtgattgaacaatggttacatcattttagc
gcggcggtaacatcgattattcaagttatcgatccagaagtttttgttctcggtggcgca
gttattttacgtcatccatggttagtagaaaagttgcatccaatggtgacaaagcgagtc
tacagcacgatgagagaagatgttcagttaaaagttgcaagccttggggacgatgcgggg
ctgtatggagcatccatgtttgtttag

DBGET integrated database retrieval system