KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0439Help
Entry
LIV_0439          CDS       T01623                                 

Definition
putative sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LIV_0439
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIV_0439
   00052 Galactose metabolism
    LIV_0439
   00500 Starch and sucrose metabolism
    LIV_0439
   00520 Amino sugar and nucleotide sugar metabolism
    LIV_0439
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LIV_0439
   00524 Butirosin and neomycin biosynthesis
    LIV_0439
Enzymes [BR:liv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LIV_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
476433..477299
Genome map
AA seq 288 aa AA seqDB search
MYRIGIDIGATNMRVALFDSDNQLIAREQVKTEAKLGPVQALGKLVSMVRLVDPERLAIG
IGIGAPGPLDVTNGTVLDAPNLPGWHGFPIRDELERLVNVPVFLMNDAKAAALAEAKIGS
GVGYDSVQYITVSTGIGGGFICRGELFPGSHGHASELGNMIVDVSSPNSTLENTCSGSAL
LRQSKQLFGENQTAAELFVQYEANQEEARQVIEQWLHHFSAAVTSIIQVIDPEVFVLGGA
VILRHPWLVEKLHPMVTKRVYSTMREDVQLKVASLGDDAGLYGASMFV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaattggaatagatatcggtgcaacgaatatgagagtggcgttgtttgattct
gacaatcagttgatagcacgtgaacaagtaaaaacagaggcgaagttaggacctgtccaa
gcattaggaaagttagtaagtatggttagactagttgatccagaacgcttagcaatcggt
attggaattggtgcacctggaccgcttgatgtgactaatggaacagttttagatgctcca
aatttacctggatggcacggattccctattagagatgagctcgagcgtcttgtaaatgta
ccagtgtttttgatgaatgatgccaaagcagctgcacttgctgaagcgaaaattggctcc
ggggtaggctacgatagtgtgcaatatatcacggtaagtacgggtattggtggtggtttc
atctgtagaggggaactgtttcctggcagtcatgggcatgcgtcagaacttgggaatatg
attgttgatgtgagttcgccaaatagtacgctggaaaacacatgtagtggtagcgccttg
ttaagacaaagtaaacaattgtttggagaaaaccagactgctgccgaattatttgtgcaa
tatgaagctaatcaggaagaagcgcgccaagtgattgaacaatggttacatcattttagc
gcggcggtaacatcgattattcaagttatcgatccagaagtttttgttctcggtggcgca
gttattttacgtcatccatggttagtagaaaagttgcatccaatggtgacaaagcgagtc
tacagcacgatgagagaagatgttcagttaaaagttgcaagccttggggacgatgcgggg
ctgtatggagcatccatgtttgtttag

DBGET integrated database retrieval system