KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0495Help
Entry
LIV_0495          CDS       T01623                                 

Gene name
hisD
Definition
(GenBank) Putative histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00340  Histidine metabolism
liv01100  Metabolic pathways
liv01110  Biosynthesis of secondary metabolites
liv01230  Biosynthesis of amino acids
Module
liv_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    LIV_0495 (hisD)
Enzymes [BR:liv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LIV_0495 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CBW84971
UniProt: G2ZBV6
Position
complement(534998..536281)
Genome map
AA seq 427 aa AA seqDB search
MNYLTGTPEDILQELLSTSSDDTSATIGAQVKAIIQKVATDGDQALFDYTRQFDQVSIQK
LRIPKETITSALAEVDEAFLEVLKQAKANIESFHIKQQQTAFIDNEKPGVIRGQLIRPLE
TVGVYVPGGTAAYPSSVLMNVLPAKIAGVNRIVMITPPGENGINPHVLAAAHIAGVDEIY
QVGGAQGIAALAYGTESIPKVAKIVGPGNIYVATAKREVFGIVDIDMIAGPSEIVVLADD
SANPAFIAADLLSQAEHDTLSRAILITTSEKIAKESESEIHSQLASLPRKRIAAEAIRSE
GKIILADNLADMFEIMNGIAPEHLEVQLENPMNYLHQIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKEKEAIILLANKEGLDAHARAIQ
IRFEEEK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaattatttaactggaacaccagaagacattttacaagaactgttatccacctcatca
gacgatacttccgctactatcggtgcccaagtaaaagcaattattcaaaaagtagcaaca
gatggtgaccaagctctatttgattacacaagacaattcgatcaagtctccatccaaaag
ttacgtattcctaaagaaactataacgtcagctttagccgaggttgatgaagccttttta
gaggtattaaaacaagcaaaagcaaatattgaaagcttccacataaaacaacaacaaacg
gcttttatagataatgaaaaaccaggtgtcattcgcggacaacttattcgtcctttagaa
accgttggcgtttatgttccaggtggtactgctgcctatccctcatccgtattaatgaat
gttttacctgctaaaattgctggagtaaaccgaatcgttatgattaccccaccaggcgaa
aatgggattaatccacatgtacttgctgctgcccacattgctggtgttgatgaaatttat
caagttggcggggctcaaggaattgctgctcttgcttatggtacagaatccatcccgaaa
gtagctaaaatcgttggtccaggaaatatttacgttgccaccgctaaacgagaagttttt
ggcatagtagatatcgatatgattgccggaccatctgaaatcgttgtgctcgctgacgat
tcagcaaacccagcatttatcgctgcagacttactctcccaagcagagcacgacacctta
tcccgtgctatcttaataaccactagcgaaaaaatcgctaaagaatccgaatcagaaatt
cacagccaactagcatcacttccaagaaaaagaattgcagcagaagcaattcgctcagaa
ggaaaaattatccttgctgataacttagcagatatgttcgaaattatgaatggaatcgcc
ccagagcatctagaagtccaactagaaaatcccatgaattatttgcatcagataaaaaat
gcaggatcgatttttctaggcagttatgcgtcagaaccacttggagattattttgctgga
cctaatcatgtattaccaacaagtggaaccgccaaatttttctcgccgctcggtgtagaa
gactttactaaacgatccgctttcatttcctatacaaaagaagctttagcaaaagagaaa
gaggcgattattttactcgcaaacaaagaaggattagatgcacatgccagagctatccaa
attcgttttgaggaggaaaagtaa

DBGET integrated database retrieval system