KEGG   Listeria ivanovii: LIV_0502Help
Entry
LIV_0502          CDS       T01623                                 

Definition
putative beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
liv  Listeria ivanovii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:liv00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542119..543513
Genome map
AA seq 464 aa AA seqDB search
MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYDIEPGRFFNDVGPANTSNFYYQ
YKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRVIDEMLANDVEPFMNLY
HFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFTFNEPIVPVEAGYLYDMH
FPNVVDFKRAVQVAYHTTLAHALAVKEFHDLKIPSGQIGIILNLTPSYPRSQNPADVKAA
HIADLIFNRSFLDPVTKGDFPADLVEIIREHDALPTYTEEDLAIIKNNIIDILGVNYYQP
RRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEIFERAIYDIAINLRDNYDNIP
FFISENGMGVEGESRYRNAGGMIEDTYRIDFIKSHLKWLHKAIEEGANCNGYHLWTFMDC
WSWANAYKNRYGLVEVDLDNNFKRTIKASGHWYKELAENNGFED
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaatttccagaaaatttttggtggggtagtgccgcttccggacctcaaaca
gaaggtgcagcaaatgtagatggtagaaaacctagtatttgggaccattggtatgatata
gaaccaggacgtttctttaatgatgttggacctgcaaatacttccaacttttattatcaa
tataaagaagatatcgctttaatgaaacaaacaggacataactctttccggacatccatt
caatggtctcgtcttattccagatggtatcggagaagtgaatccaaaagcagtcgatttt
tataatcgtgttattgatgaaatgctagcgaatgatgtagaaccatttatgaatttatat
catttcgatatgccaatgtcgatgcaagaaaaaggtggctttgaaagtcgtgaagtagta
gatgcttatgctacttttgctaaaacttgttttgaattattcggtgaccgcgtgaaacat
tggtttacttttaacgaaccaattgtaccagtagaagcaggatatttatatgatatgcac
ttcccaaatgtagttgactttaagcgcgcagtacaagtggcttaccatacgacactcgca
catgcactggcagtaaaagaattccacgatttaaaaattcctagcggtcaaatcggaatt
atcttaaacttaacaccatcttatccgcgtagccaaaacccagcagatgtcaaagcagcg
cacattgctgatttgattttcaatcgtagtttcttagatccagttacaaaaggggacttc
ccagcagatcttgtagaaattattcgtgaacatgatgcacttccaacttatacagaagaa
gatttagcgataattaaaaacaatattattgatattttaggagtcaattactatcaacca
cgccgtgtgaaagcaaaagaatacgcagcacatccggatgcaccatttatgccagaacat
ctttttgataactacgaaatgccttatcgtaaaatgaatccatatcgtggttgggaaatt
tttgaaagagcgatttatgatattgcaattaatttacgtgataactacgataatattccg
ttctttatttctgaaaatgggatgggtgtggaaggagaaagccgctaccggaatgcgggc
gggatgattgaagatacttaccggattgattttattaagagccatttgaaatggttgcat
aaagcaatagaagaaggtgcgaattgtaatggttaccatctttggacatttatggattgt
tggagctgggcaaatgcttacaaaaaccgttatggcttagtagaagttgacttggataat
aatttcaaacgaacaattaaagcatccggtcattggtacaaagaacttgcagaaaacaat
ggctttgaggactaa

DBGET integrated database retrieval system